BPHL Antibody

Images

 
Western Blot: BPHL Antibody [NBP1-88373] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-65
Immunohistochemistry-Paraffin: BPHL Antibody [NBP1-88373] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BPHL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BPHL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BPHL Protein (NBP1-88373PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BPHL Antibody

  • biphenyl hydrolase-like (serine hydrolase)
  • Biphenyl hydrolase-like protein
  • Biphenyl hydrolase-related protein
  • Bph-rp
  • Breast epithelial mucin-associated antigen
  • EC 3.1
  • MCNAA
  • MGC125930
  • MGC41865
  • VACVASE
  • valacyclovir hydrolase
  • valacyclovirase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92005
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45600
Species: Hu, Ca, Mk
Applications: WB, IHC, IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-85543
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85691
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
NBP2-02948
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00347527-B01P
Species: Hu
Applications: WB, ELISA
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-82527
Species: Hu
Applications: IHC, IHC-P
NBP1-92498
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00004502-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-97841
Species: Hu
Applications: IP (-), WB
NBP1-06983
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP, PEP-ELISA
AF2396
Species: Hu
Applications: WB, Simple Western, IHC

Publications for BPHL Antibody (NBP1-88373) (0)

There are no publications for BPHL Antibody (NBP1-88373).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BPHL Antibody (NBP1-88373) (0)

There are no reviews for BPHL Antibody (NBP1-88373). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BPHL Antibody (NBP1-88373) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BPHL Products

Bioinformatics Tool for BPHL Antibody (NBP1-88373)

Discover related pathways, diseases and genes to BPHL Antibody (NBP1-88373). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BPHL Antibody (NBP1-88373)

Discover more about diseases related to BPHL Antibody (NBP1-88373).
 

Pathways for BPHL Antibody (NBP1-88373)

View related products by pathway.

Blogs on BPHL

There are no specific blogs for BPHL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BPHL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BPHL