BORIS Recombinant Protein Antigen

Images

 
There are currently no images for BORIS Protein (NBP1-89947PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

BORIS Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CTCFL.

Source: E. coli

Amino Acid Sequence: DGVCREKDHRSPSELEAQRTSGAFQDSVLEEEVELVLAPSEESEKYILTLQTVHFTSEAVELQDMSLLSIQQQEGVQVVVQQPGPGLLWLEEGPRQSLQQCVAISIQQELYSPQEMEVLQFHALEENVMVASEDSKLAVS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CTCFL
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89947.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BORIS Recombinant Protein Antigen

  • BORISHMGB1L1
  • BORIS-like protein
  • Brother of the regulator of imprinted sites
  • Cancer/testis antigen 27
  • CCCTC-binding factor (zinc finger protein)-like
  • CCCTC-binding factor
  • CT27MGC163358
  • CTCF paralog
  • CTCF-like protein
  • CTCF-T
  • dJ579F20.2
  • HMG-1L1
  • MGC169105
  • MGC169106
  • putative high mobility group protein 1-like 1
  • putative high mobility group protein B1-like 1
  • transcriptional repressor CTCFL
  • Zinc finger protein CTCF-T

Background

BORIS (Brother of the Regulator of Imprinted Sites) also known as CCTC-binding factor-like protein, is normally only expressed in the testis and expressed in a mutually exclusive manner with CTCF during male germ cell development. However, previous studies have shown that BORIS is abnormally activated in a wide range of human cancers. Expression of BORIS in normally BORIS-negative cells promotes cell growth that may lead to transformation. BORIS maps to the cancer-associated amplification region thought to contain an oncogene or dominant-immortalizing gene. BORIS is a candidate protein for the epigenetic reprogramming factor acting in the male germ line. BORIS is found in both the nucleus and cytoplasm.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-76420
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, mIF, Simple Western, WB
NBP1-47714
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NB100-56519
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, KD, Simple Western, WB
NBP1-85431
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
292-G2
Species: Hu
Applications: BA
AF2430
Species: Hu
Applications: IP, WB
NBP1-82455
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-94859
Species: Hu, Mu, Rt
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-558
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC,  IHC-P, IP, WB
NBP1-20089
Species: Hu
Applications: ICC/IF, KD, WB
NB300-516
Species: Hu, Mu, Rt
Applications: ChIP, IHC,  IHC-P, KD, Simple Western, WB
7625
Species: Mu
Applications: ELISA
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
AF6438
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP1-87377
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89947PEP
Species: Hu
Applications: AC

Publications for BORIS Protein (NBP1-89947PEP) (0)

There are no publications for BORIS Protein (NBP1-89947PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BORIS Protein (NBP1-89947PEP) (0)

There are no reviews for BORIS Protein (NBP1-89947PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BORIS Protein (NBP1-89947PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BORIS Products

Research Areas for BORIS Protein (NBP1-89947PEP)

Find related products by research area.

Blogs on BORIS

There are no specific blogs for BORIS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BORIS Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CTCFL