Bone marrow stromal cell antigen 1/CD157 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BST1. Source: E. coli
Amino Acid Sequence: EGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
BST1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14363. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Bone marrow stromal cell antigen 1/CD157 Recombinant Protein Antigen
Background
Bone marrow stromal cell antigen-1 is a stromal cell line-derived glycosylphosphatidylinositol-anchored molecule that facilitates pre-B-cell growth. The deduced amino acid sequence exhibits 33% similarity with CD38. BST1 expression is enhanced in bone marrow stromal cell lines derived from patients with rheumatoid arthritis. The polyclonal B-cell abnormalities in rheumatoid arthritis may be, at least in part, attributed to BST1 overexpression in the stromal cell population. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA, WB
Species: Bv, Ce, Hu, I, Mu, Pl
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, PLA, WB
Species: Hu
Applications: BA
Species: Mu
Applications: AdBlk, IHC, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
Species: Mu
Applications: BA
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: AC
Publications for Bone marrow stromal cell antigen 1/CD157 Protein (NBP2-14363PEP) (0)
There are no publications for Bone marrow stromal cell antigen 1/CD157 Protein (NBP2-14363PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Bone marrow stromal cell antigen 1/CD157 Protein (NBP2-14363PEP) (0)
There are no reviews for Bone marrow stromal cell antigen 1/CD157 Protein (NBP2-14363PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Bone marrow stromal cell antigen 1/CD157 Protein (NBP2-14363PEP) (0)
Additional Bone marrow stromal cell antigen 1/CD157 Products
Research Areas for Bone marrow stromal cell antigen 1/CD157 Protein (NBP2-14363PEP)
Find related products by research area.
|
Blogs on Bone marrow stromal cell antigen 1/CD157