BNIP1 Antibody

Images

 
Western Blot: BNIP1 Antibody [NBP2-58913] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: BNIP1 Antibody [NBP2-58913] - Staining of human cell line MCF7 shows localization to endoplasmic reticulum.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BNIP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KQMLSNQASWRKANLTCKIAIDNLEKAELLQGGDLLRQRKTTKESLAQTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKL
Specificity
Specificity of human BNIP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BNIP1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BNIP1 Recombinant Protein Antigen (NBP2-58913PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for BNIP1 Antibody

  • BCL2/adenovirus E1B 19 kDa protein-interacting protein 1
  • BCL2/adenovirus E1B 19kDa interacting protein 1
  • BCL2/adenovirus E1B 19kD-interacting protein 1
  • Nip1
  • SEC20
  • SEC20L
  • Transformation-related gene 8 protein
  • TRG-8
  • vesicle transport protein SEC20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00053407-M13
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP1-87035
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56104
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-86184
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-00702
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56150
Species: Hu, Rt, Po, Ch, Xp, Mu(-)
Applications: WB, IHC, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, Func, IHC, IHC-Fr
NBP2-97553
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-24571
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-85911
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24570
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
AF4030
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-15602
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30725
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67460
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-511
Species: Hu, Mu
Applications: WB, IP

Publications for BNIP1 Antibody (NBP2-58913) (0)

There are no publications for BNIP1 Antibody (NBP2-58913).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BNIP1 Antibody (NBP2-58913) (0)

There are no reviews for BNIP1 Antibody (NBP2-58913). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BNIP1 Antibody (NBP2-58913) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional BNIP1 Products

Bioinformatics Tool for BNIP1 Antibody (NBP2-58913)

Discover related pathways, diseases and genes to BNIP1 Antibody (NBP2-58913). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BNIP1 Antibody (NBP2-58913)

Discover more about diseases related to BNIP1 Antibody (NBP2-58913).
 

Pathways for BNIP1 Antibody (NBP2-58913)

View related products by pathway.

PTMs for BNIP1 Antibody (NBP2-58913)

Learn more about PTMs related to BNIP1 Antibody (NBP2-58913).
 

Research Areas for BNIP1 Antibody (NBP2-58913)

Find related products by research area.

Blogs on BNIP1

There are no specific blogs for BNIP1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BNIP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BNIP1