ZNF787 Antibody

Western Blot: ZNF787 Antibody [NBP1-85911] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: ZNF787 Antibody [NBP1-85911] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli.

Immunohistochemistry-Paraffin: ZNF787 Antibody [NBP1-85911] - Staining of human rectum shows moderate nuclear positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ZNF787 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MELREEAWSPGPLDSEDQQMASHENPVDILIMDDDDVPSWPPTKLS
• Predicted Species: Mouse (100%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF787
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ZNF787 Protein (NBP1-85911PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ZNF787 Antibody

• TIP20
• transcription termination factor I interacting peptide 20
• TTF-I interacting peptide 20
• TTF-I-interacting peptide 20
• zinc finger protein 787

Background

ZNF787 may be involved in transcriptional regulation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF787