BMP2K Antibody

Images

 
Western Blot: BMP2K Antibody [NBP1-88602] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line HEL
Immunocytochemistry/ Immunofluorescence: BMP2K Antibody [NBP1-88602] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: BMP2K Antibody [NBP1-88602] - Staining of human duodenum shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BMP2K Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HHHHLLQDAYMQQYQHATQQQQMLQQQFLMHSVYQPQPSASQYPTMMPQYQQAFFQQQMLAQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BMP2K
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BMP2K Protein (NBP1-88602PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BMP2K Antibody

  • BIKe
  • BMP2 inducible kinase
  • BMP-2-inducible protein kinase
  • DKFZp434K0614
  • DKFZp434P0116
  • EC 2.7.11.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

355-BM/CF
Species: Hu, Mu, Rt
NBP1-76962
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC
H00004498-R01
Species: Hu
NB100-1813
Species: Hu
Applications: WB, IP
NBP1-83205
Species: Hu
Applications: WB, IHC, IHC-P
NB110-62091
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-81734
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-28875
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-27192
Species: Hu, Mu, Bv, Ca, Ch, Eq, Pm
Applications: WB, IHC-P
NBP2-31366
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57274
Species: Hu
Applications: WB, ICC/IF
NBP2-15649
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-42378
Species: Hu
Applications: WB, IHC
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF-261-NA
Species: Hu
Applications: WB, IHC, Neut
AF1195
Species: Hu
Applications: WB, IHC, Neut
AF3026
Species: Mu
Applications: WB

Publications for BMP2K Antibody (NBP1-88602) (0)

There are no publications for BMP2K Antibody (NBP1-88602).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BMP2K Antibody (NBP1-88602) (0)

There are no reviews for BMP2K Antibody (NBP1-88602). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BMP2K Antibody (NBP1-88602) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BMP2K Products

Bioinformatics Tool for BMP2K Antibody (NBP1-88602)

Discover related pathways, diseases and genes to BMP2K Antibody (NBP1-88602). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BMP2K Antibody (NBP1-88602)

Discover more about diseases related to BMP2K Antibody (NBP1-88602).
 

Pathways for BMP2K Antibody (NBP1-88602)

View related products by pathway.

Research Areas for BMP2K Antibody (NBP1-88602)

Find related products by research area.

Blogs on BMP2K

There are no specific blogs for BMP2K, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BMP2K Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BMP2K