H-2Db Antibody

Western Blot: H-2Db Antibody [NBP2-84058] - Host: Rabbit. Target Name: H2-D1. Sample Tissue: Mouse 3T3-L1 Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

H-2Db Antibody Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse H-2Db. Peptide sequence: PLGKEQKYTCHVEHEGLPEPLTLRWGKEEPPSSTKTNTVIIAVPVVLGAV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: H2-D1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for H-2Db Antibody

• H2Db
• MHC class I

Background

H-2Db is involved in antigen presentation to T cells expressing CD3/TCR and CD8 proteins. Reactivity with other haplotypes (e.g., a,d,f,k,n,p,q,r,s,u,v) has not been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: H2-D1