H-2Db Antibody

Images

 
Western Blot: H-2Db Antibody [NBP2-84058] - Host: Rabbit. Target Name: H2-D1. Sample Tissue: Mouse 3T3-L1 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

H-2Db Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse H-2Db. Peptide sequence: PLGKEQKYTCHVEHEGLPEPLTLRWGKEEPPSSTKTNTVIIAVPVVLGAV The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
H2-D1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for H-2Db Antibody

  • H2Db
  • MHC class I

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-44643
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
202-IL
Species: Hu
Applications: BA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-00178
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
AF6989
Species: Mu
Applications: IHC
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
MAB1233
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IP
AF497
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB

Publications for H-2Db Antibody (NBP2-84058) (0)

There are no publications for H-2Db Antibody (NBP2-84058).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for H-2Db Antibody (NBP2-84058) (0)

There are no reviews for H-2Db Antibody (NBP2-84058). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for H-2Db Antibody (NBP2-84058) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional H-2Db Products

Array NBP2-84058

Bioinformatics Tool for H-2Db Antibody (NBP2-84058)

Discover related pathways, diseases and genes to H-2Db Antibody (NBP2-84058). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for H-2Db Antibody (NBP2-84058)

Discover more about diseases related to H-2Db Antibody (NBP2-84058).
 

Pathways for H-2Db Antibody (NBP2-84058)

View related products by pathway.

Research Areas for H-2Db Antibody (NBP2-84058)

Find related products by research area.

Blogs on H-2Db

There are no specific blogs for H-2Db, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our H-2Db Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol H2-D1