BMP-4 Antibody (NBP2-49477)

Images

 
Western Blot: BMP-4 Antibody [NBP2-49477] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: ...read more
Immunohistochemistry: BMP-4 Antibody [NBP2-49477] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BMP-4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids:KVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEQIHSTGLEYPELP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BMP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry 1:200 - 1:500
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BMP-4 Antibody

  • BMP-2B
  • BMP2B1
  • BMP2BMCOPS6
  • BMP4
  • BMP-4
  • Bone morphogenetic protein 2B
  • bone morphogenetic protein 4
  • DVR4
  • OFC11
  • ZYME

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56656
Species: Hu, Mu, Rt
Applications: WB
NBP2-45808
Species: Hu
Applications: IHC
NBP2-24715
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NB100-56883
Species: Hu
Applications: IHC, IHC-P
AF811
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready

Publications for BMP-4 Antibody (NBP2-49477) (0)

There are no publications for BMP-4 Antibody (NBP2-49477).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BMP-4 Antibody (NBP2-49477) (0)

There are no reviews for BMP-4 Antibody (NBP2-49477). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BMP-4 Antibody (NBP2-49477) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BMP-4 Products

Related Products by Gene

Bioinformatics Tool for BMP-4 Antibody (NBP2-49477)

Discover related pathways, diseases and genes to BMP-4 Antibody (NBP2-49477). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BMP-4 Antibody (NBP2-49477)

Discover more about diseases related to BMP-4 Antibody (NBP2-49477).
 

Pathways for BMP-4 Antibody (NBP2-49477)

View related products by pathway.

PTMs for BMP-4 Antibody (NBP2-49477)

Learn more about PTMs related to BMP-4 Antibody (NBP2-49477).
 

Research Areas for BMP-4 Antibody (NBP2-49477)

Find related products by research area.

Blogs on BMP-4

There are no specific blogs for BMP-4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BMP-4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BMP4
Entrez

Customers Who Bought This Also Bought