BMP-10 Antibody


Western Blot: BMP10 Antibody [NBP1-69112] - Titration: 0.2-1 ug/ml, Positive Control: Rat Brain.

Product Details

Reactivity RtSpecies Glossary
Applications WB
Please see the vial label for concentration. If unlisted please contact technical services.

Order Details

BMP-10 Antibody Summary

Synthetic peptides corresponding to Bmp10 (bone morphogenetic protein 10) The peptide sequence was selected from the N terminal of Bmp10. Peptide sequence KFATDRTSMPSANIIRSFKNEDLFSQPVSFNGIRKYPLLFNVSIPHHEEV.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Please see the vial label for concentration. If unlisted please contact technical services.
Immunogen affinity purified


Application Notes
This is a rabbit polyclonal antibody against Bmp10 and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
48 kDa


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for BMP-10 Antibody

  • BMP10
  • BMP-10
  • bone morphogenetic protein 10
  • MGC126783


Bmp10 is required for maintaining the proliferative activity of embryonic cardiomyocytes by preventing premature activation of the negative cell cycle regulator CDKN1C/p57KIP and maintaining the required expression levels of cardiogenic factors such as MEF2C and NKX2-5. Bmp10 acts as a ligand for ACVRL1/ALK1, BMPR1A/ALK3 and BMPR1B/ALK6, leading to activation of SMAD1, SMAD5 and SMAD8 transcription factors. Bmp10 inhibits endothelial cell migration and growth.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC-P
Species: Hu
Applications: ICC
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC

Publications for BMP-10 Antibody (NBP1-69112) (0)

There are no publications for BMP-10 Antibody (NBP1-69112).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BMP-10 Antibody (NBP1-69112) (0)

There are no reviews for BMP-10 Antibody (NBP1-69112). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BMP-10 Antibody (NBP1-69112) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional BMP-10 Antibody Products

Related Products by Gene

Bioinformatics Tool for BMP-10 Antibody (NBP1-69112)

Discover related pathways, diseases and genes to BMP-10 Antibody (NBP1-69112). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BMP-10 Antibody (NBP1-69112)

Discover more about diseases related to BMP-10 Antibody (NBP1-69112).

Pathways for BMP-10 Antibody (NBP1-69112)

View related products by pathway.

PTMs for BMP-10 Antibody (NBP1-69112)

Learn more about PTMs related to BMP-10 Antibody (NBP1-69112).

Blogs on BMP-10

There are no specific blogs for BMP-10, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol BMP10

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-69112 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought