BMP-10 Antibody


Western Blot: BMP10 Antibody [NBP1-69112] - Titration: 0.2-1 ug/ml, Positive Control: Rat Brain.

Product Details

Reactivity RtSpecies Glossary
Applications WB

Order Details

BMP-10 Antibody Summary

Synthetic peptides corresponding to Bmp10 (bone morphogenetic protein 10) The peptide sequence was selected from the N terminal of Bmp10. Peptide sequence KFATDRTSMPSANIIRSFKNEDLFSQPVSFNGIRKYPLLFNVSIPHHEEV.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Bmp10 and was validated on Western blot.
Theoretical MW
48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for BMP-10 Antibody

  • BMP10
  • BMP-10
  • bone morphogenetic protein 10
  • MGC126783


Bmp10 is required for maintaining the proliferative activity of embryonic cardiomyocytes by preventing premature activation of the negative cell cycle regulator CDKN1C/p57KIP and maintaining the required expression levels of cardiogenic factors such as MEF2C and NKX2-5. Bmp10 acts as a ligand for ACVRL1/ALK1, BMPR1A/ALK3 and BMPR1B/ALK6, leading to activation of SMAD1, SMAD5 and SMAD8 transcription factors. Bmp10 inhibits endothelial cell migration and growth.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Species: Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
Species: Mu
Applications: IHC
Species: Hu
Species: Hu
Applications: ICC
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Mu
Species: Hu
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Rt
Applications: WB

Publications for BMP-10 Antibody (NBP1-69112) (0)

There are no publications for BMP-10 Antibody (NBP1-69112).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BMP-10 Antibody (NBP1-69112) (0)

There are no reviews for BMP-10 Antibody (NBP1-69112). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BMP-10 Antibody (NBP1-69112) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional BMP-10 Products

Bioinformatics Tool for BMP-10 Antibody (NBP1-69112)

Discover related pathways, diseases and genes to BMP-10 Antibody (NBP1-69112). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BMP-10 Antibody (NBP1-69112)

Discover more about diseases related to BMP-10 Antibody (NBP1-69112).

Pathways for BMP-10 Antibody (NBP1-69112)

View related products by pathway.

PTMs for BMP-10 Antibody (NBP1-69112)

Learn more about PTMs related to BMP-10 Antibody (NBP1-69112).

Blogs on BMP-10

There are no specific blogs for BMP-10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our BMP-10 Antibody and receive a gift card or discount.


Gene Symbol BMP10