BLZF1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: BLZF1 Antibody [NBP2-57824] - Staining of human cell line U-251 MG shows localization to nucleus & the Golgi apparatus.

• Reactivity: Hu, Mu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BLZF1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IPSTVEFCSTPAEKMAETVLRILDPVTCKESSPDNPFFESSPTTLLATKKNIGRFHPYTRYENITFNCCNHCRGELIAL
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BLZF1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  BLZF1 Recombinant Protein Antigen (NBP2-57824PEP)

Reactivity Notes

Rat 80%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for BLZF1 Antibody - BSA Free

• basic leucine zipper nuclear factor 1JEM-1s
• cytoplasmic protein
• GOLGIN-45
• JEM1
• JEM-1MGC22497
• JEM-1short protein
• p45 basic leucine-zipper nuclear factor

Background

BLZF1 is required for normal Golgi structure and for protein transport from the endoplasmic reticulum (ER) through the Golgi apparatus to the cell surface

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BLZF1