BLZF1 Antibody - BSA Free

Immunohistochemistry-Paraffin: BLZF1 Antibody [NBP1-83081] - Staining of human stomach shows strong nuclear positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BLZF1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ETKVTVTSSPIRGAGDGMETEEPPKSVEVTSGVRSRKHHSLQSPWKKAVPSESPGVLQLGKMLTEKAMEVKAVRI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BLZF1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
• Control Peptide:

  BLZF1 Protein (NBP1-83081PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for BLZF1 Antibody - BSA Free

• basic leucine zipper nuclear factor 1JEM-1s
• cytoplasmic protein
• GOLGIN-45
• JEM1
• JEM-1MGC22497
• JEM-1short protein
• p45 basic leucine-zipper nuclear factor

Background

BLZF1 is required for normal Golgi structure and for protein transport from the endoplasmic reticulum (ER) through the Golgi apparatus to the cell surface

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BLZF1