BLAP75 Antibody

Images

 
Western Blot: BLAP75 Antibody [NBP1-58133] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BLAP75 Antibody Summary

Immunogen
Synthetic peptides corresponding to RMI1(RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of RMI1 (NP_079221). Peptide sequence DGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RMI1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against RMI1 and was validated on Western blot.
Theoretical MW
70 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-58133.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for BLAP75 Antibody

  • 75 kDa
  • BLM-associated protein 75 kDa
  • BLM-associated protein of 75 kDa
  • chromosome 9 open reading frame 76
  • FAAP75
  • FLJ12888
  • homolog of yeast RecQ-mediated genome instability 1 (RMI1)
  • recQ-mediated genome instability protein 1
  • RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae)
  • RMI2

Background

RMI1 is an essential component of the RMI complex, a complex that plays an important role in the processing of homologous recombination intermediates to limit DNA crossover formation in cells. RMI1 promotes TOP3A binding to double Holliday junctions (DHJ) and hence stimulates TOP3A-mediated dissolution. RMI1 is required for BLM phosphorylation during mitosis. Within the BLM complex, RMI1 is required for BLM and TOP3A stability.RMI1 is a component of protein complexes that limit DNA crossover formation via the dissolution of double Holliday junctions (Raynard et al., 2006 [PubMed 16595695]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-136 BP327553.1 1-136 137-885 DN997105.1 9-757 886-2740 AL732446.4 14777-16631 2741-3508 BC039999.2 2566-3333

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-214
Species: Hu, Mu
Applications: WB, IP
NBP2-67219
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-89962
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-471
Species: Hu
Applications: WB, ICC/IF, IHC, IP, ChIP
NB100-148
Species: Hu, Mu, Rt, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, KD
NBP1-33169
Species: Hu, Mu
Applications: WB
NB100-2064
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IP, CyTOF-ready
H00054821-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-57190
Species: Hu
Applications: ICC/IF
NBP1-89827
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75656
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87691
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00171023-M05
Species: Hu
Applications: WB, ELISA, IP
NBP1-28680
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP, ChIP
NBP2-30783
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58133
Species: Hu
Applications: WB

Publications for BLAP75 Antibody (NBP1-58133)(1)


Showing Publication 1 - 1 of 1.
Publication using NBP1-58133 Applications Species
Broberg,K. Cancer Lett. 258 (1), 38-44. 2007 [PMID: 17900800]

Reviews for BLAP75 Antibody (NBP1-58133) (0)

There are no reviews for BLAP75 Antibody (NBP1-58133). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BLAP75 Antibody (NBP1-58133) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional BLAP75 Products

Bioinformatics Tool for BLAP75 Antibody (NBP1-58133)

Discover related pathways, diseases and genes to BLAP75 Antibody (NBP1-58133). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BLAP75 Antibody (NBP1-58133)

Discover more about diseases related to BLAP75 Antibody (NBP1-58133).
 

Pathways for BLAP75 Antibody (NBP1-58133)

View related products by pathway.

PTMs for BLAP75 Antibody (NBP1-58133)

Learn more about PTMs related to BLAP75 Antibody (NBP1-58133).

Blogs on BLAP75

There are no specific blogs for BLAP75, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BLAP75 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RMI1
Entrez
Uniprot
Novus 100% Guarantee