RMI2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: RMI2 Antibody [NBP1-89962] - Staining of human cell line U-251 MG shows localization to nuclear speckles and cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: RMI2 Antibody [NBP1-89962] - Staining of human lymph node shows strong nuclear positivity in germinal-center and non-germinal center cells.

Immunohistochemistry-Paraffin: RMI2 Antibody [NBP1-89962] - Staining of human colon shows strong nuclear positivity in lymphoid cells and glandular cells.

Immunohistochemistry-Paraffin: RMI2 Antibody [NBP1-89962] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.

Staining of human lymph node shows strong nuclear positivity in germinal-center and non-germinal center cells.

Staining of human skeletal muscle shows no nuclear positivity in myocytes as expected.

Staining of human lymph node shows strong nuclear positivity in germinal-center and non-germinal center cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RMI2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RMI2 Antibody - BSA Free (NBP1-89962) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-RMI2 Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNI
• Localization: Cytoplasm
• Predicted Species: Mouse (98%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RMI2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot Reactivity reported (PMID: 33500419)
• Application Notes: IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RMI2 Protein (NBP1-89962PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RMI2 Antibody - BSA Free

• BLAP18RMI2
• BLM-associated protein of 18 kDa
• chromosome 16 open reading frame 75
• hRMI2
• MGC24665
• RecQ-mediated genome instability 2, S. cerevisiae, homolog of
• recQ-mediated genome instability protein 2

Background

RMI2 is a component of the BLM (RECQL3; MIM 604610) complex, which plays a role in homologous recombination-dependentDNA repair and is essential for genome stability (Xu et al., 2008 (PubMed 18923082)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RMI2 Antibody (NBP1-89962)(4)

Publications using NBP1-89962

• GonzAlez-Acosta D, Blanco-Romero E, Ubieto-Capella P et al. PrimPol-mediated repriming facilitates replication traverse of DNA interstrand crosslinks The EMBO journal 2021-06-15 [PMID: 34128550]
• Shorrocks AK, Jones SE, Tsukada K, et al. The Bloom syndrome complex senses RPA-coated single-stranded DNA to restart stalled replication forks Nature communications 2021-01-26 [PMID: 33500419] (WB)
• Wu W, Rokutanda N et al. HERC2 Facilitates BLM and WRN Helicase Complex Interaction with RPA to Suppress G-Quadruplex DNA. Cancer Res 2018-11-15 [PMID: 30279242] (WB, Human)
• Andrew N. Blackford, Jadwiga Nieminuszczy, Rebekka A. Schwab, Yaron Galanty, Stephen P. Jackson, Wojciech Niedzwiedz TopBP1 Interacts with BLM to Maintain Genome Stability but Is Dispensable for Preventing BLM Degradation Molecular Cell 2015-03-19 [PMID: 25794620]

Bioinformatics

• Gene Symbol: RMI2
• Entrez:
  • 116028(Human)
• Uniprot:
  • Q96E14(Human)