RMI2 Antibody

Images

 
Western Blot: RMI2 Antibody [NBP1-89962] - Analysis in human cell line HepG2.
Immunocytochemistry/ Immunofluorescence: RMI2 Antibody [NBP1-89962] - Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear speckles & cytosol.
Immunohistochemistry-Paraffin: RMI2 Antibody [NBP1-89962] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RMI2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNI
Localization
Cytoplasm
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RMI2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RMI2 Protein (NBP1-89962PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RMI2 Antibody

  • BLAP18RMI2
  • BLM-associated protein of 18 kDa
  • chromosome 16 open reading frame 75
  • hRMI2
  • MGC24665
  • RecQ-mediated genome instability 2, S. cerevisiae, homolog of
  • recQ-mediated genome instability protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89929
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-32016
Species: Hu
Applications: IHC, IHC-P
NB600-1468
Species: Hu
Applications: WB, IHC-P, S-ELISA
NB100-2204
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PLA
NBP2-30783
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1790
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-83761
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1585
Species: Hu
Applications: WB (-), ICC/IF, IHC-P, IP, PLA
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP2-37467
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-28680
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP
NBP1-32054
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-50418
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-89962
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RMI2 Antibody (NBP1-89962) (0)

There are no publications for RMI2 Antibody (NBP1-89962).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RMI2 Antibody (NBP1-89962) (0)

There are no reviews for RMI2 Antibody (NBP1-89962). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RMI2 Antibody (NBP1-89962) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RMI2 Products

Bioinformatics Tool for RMI2 Antibody (NBP1-89962)

Discover related pathways, diseases and genes to RMI2 Antibody (NBP1-89962). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RMI2 Antibody (NBP1-89962)

Discover more about diseases related to RMI2 Antibody (NBP1-89962).
 

Pathways for RMI2 Antibody (NBP1-89962)

View related products by pathway.

PTMs for RMI2 Antibody (NBP1-89962)

Learn more about PTMs related to RMI2 Antibody (NBP1-89962).

Blogs on RMI2

There are no specific blogs for RMI2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RMI2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RMI2
Entrez
Uniprot