Biliverdin Reductase B/BLVRB Antibody (2F4)

Images

 
Western Blot: Biliverdin Reductase B/BLVRB Antibody (2F4) [H00000645-M09] - Analysis of BLVRB expression in transfected 293T cell line by BLVRB monoclonal antibody (M09), clone 2F4. Lane 1: BLVRB transfected lysatE ...read more
ELISA: Biliverdin Reductase B/BLVRB Antibody (2F4) [H00000645-M09] - Detection limit for recombinant GST tagged BLVRB is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2F4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Biliverdin Reductase B/BLVRB Antibody (2F4) Summary

Immunogen
BLVRB (NP_000704, 107 a.a. - 206 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VACTSAFLLWDPTKVPPRLQAVTDDHIRMHKVLRESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTDEYDGHSTYPSHQYQ
Specificity
BLVRB - biliverdin reductase B (flavin reductase (NADPH))
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BLVRB
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00000645-M09.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Biliverdin Reductase B/BLVRB Antibody (2F4)

  • biliverdin reductase B (flavin reductase (NADPH))
  • Biliverdin Reductase B
  • Biliverdin-IX beta-reductase
  • BLVRB
  • BVRB
  • BVR-B
  • EC 1.3.1.24
  • EC 1.5.1.30
  • flavin reductase (NADPH)
  • flavin reductase
  • FLR
  • FLRBVRB
  • FR
  • GHBP
  • Green heme-binding protein
  • MGC117413
  • NADPH-dependent diaphorase
  • NADPH-flavin reductase
  • SDR43U1
  • short chain dehydrogenase/reductase family 43U, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-07799
Species: Hu
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
MAB3307
Species: Hu
Applications: WB, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-836
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for Biliverdin Reductase B/BLVRB Antibody (H00000645-M09)(1)

Reviews for Biliverdin Reductase B/BLVRB Antibody (H00000645-M09) (0)

There are no reviews for Biliverdin Reductase B/BLVRB Antibody (H00000645-M09). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Biliverdin Reductase B/BLVRB Antibody (H00000645-M09) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Biliverdin Reductase B/BLVRB Products

Bioinformatics Tool for Biliverdin Reductase B/BLVRB Antibody (H00000645-M09)

Discover related pathways, diseases and genes to Biliverdin Reductase B/BLVRB Antibody (H00000645-M09). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Biliverdin Reductase B/BLVRB Antibody (H00000645-M09)

Discover more about diseases related to Biliverdin Reductase B/BLVRB Antibody (H00000645-M09).
 

Pathways for Biliverdin Reductase B/BLVRB Antibody (H00000645-M09)

View related products by pathway.

Blogs on Biliverdin Reductase B/BLVRB

There are no specific blogs for Biliverdin Reductase B/BLVRB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Biliverdin Reductase B/BLVRB Antibody (2F4) and receive a gift card or discount.

Bioinformatics

Gene Symbol BLVRB
Entrez
OMIM
Uniprot