Orthogonal Strategies: Immunohistochemistry-Paraffin: Biglycan Antibody [NBP1-84971] - Analysis in human placenta and skeletal muscle tissues. Corresponding BGN RNA-seq data are presented for the same tissues.
Biological Strategies: Western Blot: Biglycan Antibody [NBP1-84971] - Treatment of CAFs with combined cytokines or cancer cell-derived secretomes affects ECM protein expression. Western blot showing the effects ...read more
Immunocytochemistry/ Immunofluorescence: Biglycan Antibody [NBP1-84971] - Staining of human cell line BJ shows localization to endoplasmic reticulum & the Golgi apparatus. Antibody staining is shown in green.
Western Blot: Biglycan Antibody [NBP1-84971] - Analysis in human cell line U-138 MG.
Western Blot: Biglycan Antibody [NBP1-84971] - Analysis in control (vector only transfected HEK293T lysate) and BGN over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: Biglycan Antibody [NBP1-84971] - Staining of human testis shows weak to moderate cytoplasmic positivity in peritubular myoid cells.
Immunohistochemistry-Paraffin: Biglycan Antibody [NBP1-84971] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: Biglycan Antibody [NBP1-84971] - Staining of human kidney shows moderate extracellular space positivity.
Immunohistochemistry-Paraffin: Biglycan Antibody [NBP1-84971] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Western Blot: Biglycan Antibody [NBP1-84971] - Treatment of CAFs with combined cytokines or cancer cell-derived secretomes affects ECM protein expression(A) Western blot showing the effects of bFGF, EGF & TGF-beta 1 ...read more
Western Blot: Biglycan Antibody [NBP1-84971] - Treatment of CAFs with combined cytokines or cancer cell-derived secretomes affects ECM protein expression(A) Western blot showing the effects of bFGF, EGF & TGF-beta 1 ...read more
Novus Biologicals Rabbit Biglycan Antibody - BSA Free (NBP1-84971) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Biglycan Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSL
Predicted Species
Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BGN
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Use in Mouse reported in scientific literature (PMID:35008869).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for Biglycan Antibody - BSA Free
BGN
Biglycan
Bone/cartilage proteoglycan I
bone/cartilage proteoglycan-I
dermatan sulphate proteoglycan I
DSPG1
PGI
PG-S1
SLRR1A
SLRR1Abiglycan proteoglycan
small leucine-rich protein 1A
Background
Biglycan is encoded by this gene is a small cellular or pericellular matrix proteoglycan that is closely related in structure to two other small proteoglycans, decorin and fibromodulin. The encoded protein and decorin are thought to be the result of a gene duplication. Decorin contains one attached glycosaminoglycan chain, while this protein probably contains two chains. For this reason, this protein is called biglycan. This protein is thought to function in connective tissue metabolism by binding to collagen fibrils and transfering growth factor-beta. It may promote neuronal survival. This gene is a candidate gene for the Happle syndrome.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
FAQs for Biglycan Antibody (NBP1-84971). (Showing 1 - 1 of 1 FAQs).
I have a question regarding the Biglycan antibody NBP1-84971. It is stated that the species reactivity is human; is there a chance it will work in mice to, or do you known for a fact that the antibody does not label mouse tissues? I need a anti-biglycan antibody, for IHC (paraffin) on mouse tissue; can you recommend any of your antibodies for this purpose?
We have not yet tested this antibody on mouse, however the % homology is 95%, and our lab recommends use when the homology is 85% or above. If you would like to test this you could apply for our Innovators Reward Program. Unfortunately we do not have an anti Biglycan that has been validated for use in both mouse and IHC-P.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Biglycan Antibody - BSA Free and receive a gift card or discount.