Biglycan Antibody

Images

 
Western Blot: Biglycan Antibody [NBP1-84971] - Analysis in human cell line U-138 MG.
Immunocytochemistry/ Immunofluorescence: Biglycan Antibody [NBP1-84971] - Staining of human cell line BJ shows localization to endoplasmic reticulum & the Golgi apparatus.
Immunohistochemistry-Paraffin: Biglycan Antibody [NBP1-84971] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Biglycan Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BGN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Biglycan Protein (NBP1-84971PEP)
Publications
Read Publications using
NBP1-84971 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Biglycan Antibody

  • BGN
  • Biglycan
  • Bone/cartilage proteoglycan I
  • bone/cartilage proteoglycan-I
  • dermatan sulphate proteoglycan I
  • DSPG1
  • PGI
  • PG-S1
  • SLRR1A
  • SLRR1Abiglycan proteoglycan
  • small leucine-rich protein 1A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-85432
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5945
Species: Hu, Mu, Rt
Applications: WB
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91012
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7788
Species: Hu
Applications: WB, Simple Western
NBP1-87311
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-84971
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Biglycan Antibody (NBP1-84971)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Biglycan Antibody (NBP1-84971) (0)

There are no reviews for Biglycan Antibody (NBP1-84971). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Biglycan Antibody (NBP1-84971). (Showing 1 - 1 of 1 FAQs).

  1. I have a question regarding the Biglycan antibody NBP1-84971. It is stated that the species reactivity is human; is there a chance it will work in mice to, or do you known for a fact that the antibody does not label mouse tissues? I need a anti-biglycan antibody, for IHC (paraffin) on mouse tissue; can you recommend any of your antibodies for this purpose?
    • We have not yet tested this antibody on mouse, however the % homology is 95%, and our lab recommends use when the homology is 85% or above. If you would like to test this you could apply for our Innovators Reward Program. Unfortunately we do not have an anti Biglycan that has been validated for use in both mouse and IHC-P.

Secondary Antibodies

 

Isotype Controls

Additional Biglycan Products

Bioinformatics Tool for Biglycan Antibody (NBP1-84971)

Discover related pathways, diseases and genes to Biglycan Antibody (NBP1-84971). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Biglycan Antibody (NBP1-84971)

Discover more about diseases related to Biglycan Antibody (NBP1-84971).
 

Pathways for Biglycan Antibody (NBP1-84971)

View related products by pathway.

PTMs for Biglycan Antibody (NBP1-84971)

Learn more about PTMs related to Biglycan Antibody (NBP1-84971).

Blogs on Biglycan

There are no specific blogs for Biglycan, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Biglycan Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BGN
Entrez