BICD1 Antibody

Images

 
Western Blot: BICD1 Antibody [NBP1-85843] - Analysis in human cell line NTERA-2.
Immunohistochemistry-Paraffin: BICD1 Antibody [NBP1-85843] - Staining of human rectum shows moderate cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BICD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YRQSRVTRSGSLKGPDDPRGLLSPRLARRGVSSPVETRTSSEPVAKESTEASKEPSPTKTPTISPVITAPPSSPVLDTSDIRKE
Specificity
Specificity of human BICD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BICD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BICD1 Protein (NBP1-85843PEP)
Publications
Read Publication using NBP1-85843.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24920579)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BICD1 Antibody

  • Bicaudal D (Drosophila) homolog 1
  • bicaudal D homolog 1 (Drosophila)
  • Bic-D 1
  • BICD
  • cytoskeleton-like bicaudal D protein homolog 1
  • protein bicaudal D homolog 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81488
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-93990
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33425
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21667
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-31310
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD, KO
NBP2-01770
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00002011-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00027349-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-49382
Species: Hu
Applications: IHC, IHC-P
NBP1-47470
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-85843
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for BICD1 Antibody (NBP1-85843)(1)

Reviews for BICD1 Antibody (NBP1-85843) (0)

There are no reviews for BICD1 Antibody (NBP1-85843). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BICD1 Antibody (NBP1-85843) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional BICD1 Products

Array NBP1-85843

Bioinformatics Tool for BICD1 Antibody (NBP1-85843)

Discover related pathways, diseases and genes to BICD1 Antibody (NBP1-85843). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BICD1 Antibody (NBP1-85843)

Discover more about diseases related to BICD1 Antibody (NBP1-85843).
 

Pathways for BICD1 Antibody (NBP1-85843)

View related products by pathway.

PTMs for BICD1 Antibody (NBP1-85843)

Learn more about PTMs related to BICD1 Antibody (NBP1-85843).

Blogs on BICD1

There are no specific blogs for BICD1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BICD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BICD1