Home » BICD1 » BICD1 Antibodies » BICD1 Antibody

BICD1 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: BICD1 Antibody [NBP1-85843] - Analysis in human cell line NTERA-2.
Western Blot: BICD1 Antibody [NBP1-85843] - Analysis in human cell line NTERA-2.
Immunohistochemistry-Paraffin: BICD1 Antibody [NBP1-85843] - Staining of human rectum shows moderate cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

BICD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YRQSRVTRSGSLKGPDDPRGLLSPRLARRGVSSPVETRTSSEPVAKESTEASKEPSPTKTPTISPVITAPPSSPVLDTSDIRKE
Specificity
Specificity of human BICD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BICD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BICD1 Protein (NBP1-85843PEP)
Publications
Read Publication using NBP1-85843.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24920579)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BICD1 Antibody

  • Bicaudal D (Drosophila) homolog 1
  • bicaudal D homolog 1 (Drosophila)
  • Bic-D 1
  • BICD
  • cytoskeleton-like bicaudal D protein homolog 1
  • protein bicaudal D homolog 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

RAB6A Antibody
NBP1-33110
Knockout Validated: RAB6A Antibody [NBP1-33110] - Wild-type (WT) and RAB6A knockout (KO) 293T cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with RAB6A antibody diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: RAB6A Antibody [NBP1-33110] - Wild-type (WT) and RAB6A knockout (KO) 293T cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with RAB6A antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: RAB6A Antibody [NBP1-33110] - A549 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: RAB6A protein stained by RAB6A antibody diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
BBS9 Antibody
NBP1-88927
Immunohistochemistry-Paraffin: BBS9 Antibody [NBP1-88927] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
(3 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
LMOD1 Antibody
NBP1-89396
Western Blot: LMOD1 Antibody [NBP1-89396] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: LMOD1 Antibody [NBP1-89396] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LMOD1 Antibody [NBP1-89396] - Staining of human smooth muscle.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
BICD2 Antibody
NBP1-81488
Immunohistochemistry-Paraffin: BICD2 Antibody [NBP1-81488] - Staining in human skin and liver tissues using anti-BICD2 antibody. Corresponding BICD2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: BICD2 Antibody [NBP1-81488] - Staining of human liver, lymph node, skin and testis using Anti-BICD2 antibody NBP1-81488 (A) shows similar protein distribution across tissues to independent antibody NBP1-81489 (B).
Western Blot: BICD2 Antibody [NBP1-81488] - Role of BICD1 in dynein-mediated HIF1alpha nuclear translocation in UCB-MSCs. Co-immunoprecipitation of BICD1, BICD2, Dynein IC, and alpha-Tubulin with IgG and HIF1alpha antibodies were shown in left panel. Total protein expressions in lysate were shown in right panel. n = 3. *p < 0.05 vs. normoxia control. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41418-018-0241-1), licensed under a CC-BY licence.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PAR1/Thrombin
Receptor Antibody (N2
NBP1-71770
Immunohistochemistry: PAR1/Thrombin Receptor Antibody (N2-11) [NBP1-71770] - PAR1 is expressed by neural stem cells in the sub-ventricular zone (SVZ) of the adult mouse brain. Photomicrographs show immunofluorescence double-labeling for PAR1 with Sox2-positive multipotent neural stem cells (NSCs) within the lateral wall of the lateral ventricle (LV). RNAscope was used to identify cells expressing both PAR1 and Sox2. RNA in NSCs of the adult SVZ. Arrow indicates an example of a double-labeled cell in each case, with arrowhead indicating a singly labeled cell (Scale bar = 10 um). Boxed area in B is also shown at higher magnification to visualize double-labeled cells. Image collected and cropped by Cite Ab from the following publication (The Thrombin Receptor Restricts Subventricular Zone Neural Stem Cell Expansion and Differentiation. Sci Rep (2018) licensed under a CC-BY licence.
Western Blot: PAR1/Thrombin Receptor Antibody (N2-11) [NBP1-71770] - Analysis of Thrombin Receptor expression in human testis using NBP1-71770.
Immunohistochemistry: PAR1/Thrombin Receptor Antibody (N2-11) [NBP1-71770] - PAR1 is expressed by neural stem cells in the sub-ventricular zone (SVZ) of the adult mouse brain. Photomicrographs show immunofluorescence double-labeling for PAR1 with Nestin-positive multipotent neural stem cells (NSCs) within the lateral wall of the lateral ventricle (LV). RNAscope was used to identify cells expressing both PAR1 and Nestin. RNA in NSCs of the adult SVZ. Arrow indicates an example of a double-labeled cell in each case, with arrowhead indicating a singly labeled cell (Scale bar = 10 um). Boxed area in D is also shown at higher magnification to visualize double-labeled cells. Image collected and cropped by Cite Ab from the following publication (The Thrombin Receptor Restricts Subventricular Zone Neural Stem Cell Expansion and Differentiation. Sci Rep (2018) licensed under a CC-BY licence.
(7 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
LIS1 Antibody
NBP1-87769
Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769] - Analysis in human testis and liver tissues using NBP1-87769 antibody. Corresponding PAFAH1B1 RNA-seq data are presented for the same tissues.
Western Blot: LIS1 Antibody [NBP1-87769] - Analysis of LIS1 in caco-2 whole cell lysate using anti-LIS1 antibody. Image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: LIS1 Antibody [NBP1-87769] - Staining of human cell line U-251 MG shows localization to centrosome. Antibody staining is shown in green.
(2 Reviews)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PXR/NR1I2 Antibody
(H4417) [Unconjugated ...
PP-H4417-00
PXR/NR1I2 Antibody (H4417) [Unconjugated]
(1 Publication)
Species: Hu
Applications: WB, IP, DirELISA
Ninein Antibody
NBP2-93990
Western Blot: Ninein Antibody [NBP2-93990] - Analysis of extracts of Jurkat cells, using Ninein.Exposure time: 90s.
Immunocytochemistry/Immunofluorescence: Ninein Antibody [NBP2-93990] - Analysis of U2OS cells using Ninein at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Ninein Antibody [NBP2-93990] - Paraffin-embedded rat kidney using Ninein.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
KLC1 Antibody
NBP2-33425
Western Blot: KLC1 Antibody [NBP2-33425] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: KLC1 Antibody [NBP2-33425] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts.
Species: Hu
Applications: WB, IHC, IHC-P
HIV-1 Rev binding
protein (HRB) Antibod ...
NBP1-91991
Western Blot: HIV-1 Rev binding protein (HRB) Antibody [NBP1-91991] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: HIV-1 Rev binding protein (HRB) Antibody [NBP1-91991] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
Immunohistochemistry-Paraffin: HIV-1 Rev binding protein (HRB) Antibody [NBP1-91991] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Kinesin 5B Antibody
NBP2-21667
Western Blot: Kinesin 5B Antibody [NBP2-21667] - Glucocorticoid promoted microtubule destabilization and following transport impairment. The hippocampus of mice exposed to rapamycin (8 mg/kg) for 2 days before corticosterone (10 mg/kg) for 24 h was collected and lysed. alpha-tubulin was co-immunoprecipitated with an anti-kinesin-1 antibody (the left side). Expression of kinesin-1 and alpha-tubulin in total cell lysates is shown in the right side. ** indicates p < 0.01 vs. vehicle. # indicates p < 0.05 vs. corticosterone alone. n = 4. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41419-018-1172-y) licensed under a CC-BY licence.
Immunohistochemistry: Kinesin Antibody [NBP2-21667] - 40X in human brain at pH 6. Tissue: Human Brain.
Western Blot: Kinesin Antibody [NBP2-21667] - Rabbit anti-Kinesin 1 Antibody. Lane 1: 500 ng of truncated kinesin 1 protein. Lane 2: 20 ug of Mouse Brain lysate. Lane 3: 10 ug of Mouse Brain lysate. kinesin1 antibody at 1:1000 for overnight at 4C. Secondary antibody: Dye800 rabbit secondary antibody at 1:40,000 for 1hr at RT. Block: 5% Blocking Buffer1 hr at RT. Predicted/Observed size: 72 kDa, ~70 kDa for kinesin-1. Other band: degradation.
(1 Publication)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Annexin A2 Antibody
NBP1-31310
Knockout Validated: Annexin A2 Antibody [NBP1-31310] - Wild-type (WT) and Annexin II knockout (KO) HeLa cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Annexin II antibody [N1], N-term. The HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Western Blot: Annexin A2 Antibody [NBP1-31310] - Analysis. Non-transfected (-) and human Annexin I or Annexin II-transfected (+) whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Annexin II antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: Annexin A2 Antibody [NBP1-31310] - Confocal immunofluorescence analysis (Olympus FV10i) of paraformaldehyde-fixed HeLa, using Annexin A2 Antibody antibody (Green) at 1:500 dilution. Alpha-tubulin filaments were labeled Red.
(7 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD, KO
FMRP Antibody
(OTI1C6)
NBP2-01770
Western Blot: FMRP Antibody (1C6) [NBP2-01770] Analysis of extracts (35ug) from 9 different cell lines by using anti-FMRP monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunocytochemistry/Immunofluorescence: FMRP Antibody (1C6) [NBP2-01770] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY FMRP.
Immunohistochemistry-Paraffin: FMRP Antibody (1C6) [NBP2-01770] - Staining of paraffin-embedded Human pancreas tissue using anti-FMRP mouse monoclonal antibody.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MARK2 Antibody
(3B12)
H00002011-M01
Western Blot: MARK2 Antibody (3B12) [H00002011-M01] - MARK2 monoclonal antibody (M01), clone 3B12. Analysis of MARK2 expression in NIH/3T3.
Western Blot: MARK2 Antibody (3B12) [H00002011-M01] - MARK2 monoclonal antibody (M01), clone 3B12. Analysis of MARK2 expression in PC-12.
Western Blot: MARK2 Antibody (3B12) [H00002011-M01] - MARK2 monoclonal antibody (M01), clone 3B12. Analysis of MARK2 expression in A-431.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
MCAT Antibody (2F2)
H00027349-M01
Western Blot: MCAT Antibody (2F2) [H00027349-M01] - MT monoclonal antibody (M01), clone 2F2 Analysis of MT expression in HeLa.
Immunohistochemistry-Paraffin: MCAT Antibody (2F2) [H00027349-M01] - Analysis of monoclonal antibody to MT on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.
Sandwich ELISA: MCAT Antibody (2F2) [H00027349-M01] - Detection limit for recombinant GST tagged MT is approximately 1ng/ml as a capture antibody.
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
GPR172A Antibody
NBP2-49382
Immunohistochemistry: GPR172A Antibody [NBP2-49382] - Staining of human small intestine shows moderate cytoplasmic and membranous positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P
GSK-3 beta
Antibody (3D10)
NBP1-47470
Western Blot: GSK-3 beta Antibody (3D10) [NBP1-47470] - Analysis of GSK-3 beta in mouse beta cell line (betaTC3) using anti-GSK-3 beta antibody. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: GSK-3 beta Antibody (3D10) [NBP1-47470] - Analysis of NIH/3T3 (left) and U251 (right) cells using GSK3 beta mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry: GSK-3 beta Antibody (3D10) [NBP1-47470] - Fap1-inhibition with SLV peptide increases phosphorylation of Fap1-substrates Fas and GSK-3 beta in a murine xenograft model. SW620 cells injected into flanks of athymic Nude mice & tumor volume was checked biweekly. Mice treated weekly with oxaliplatin (days 0, 7 and 14) & injected daily with Fap1 blocking SLV peptide, VLS control peptide, or treated with SLV or VLS peptide alone (n=12). Tumors were simultaneously harvested when control tumors were >2,000 mm3. SLV peptide increases Gsk3-phosphorylation with/without oxaliplatin. IF detection of total versus phospho- GSK-3 beta performed with DAPI staining of nuclei (areas without gland formation were selected). Image collected and cropped by CiteAb from the following publication (https://www.oncotarget.com/lookup/doi/10.18632/oncotarget.25401), licensed under a CC-BY licence.
(4 Reviews)
(4 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
BICD1 Antibody
NBP1-85843
BICD1 Antibody
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for BICD1 Antibody (NBP1-85843)(1)


Reviews for BICD1 Antibody (NBP1-85843) (0)

There are no reviews for BICD1 Antibody (NBP1-85843). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BICD1 Antibody (NBP1-85843) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional BICD1 Products

Array NBP1-85843

Bioinformatics Tool for BICD1 Antibody (NBP1-85843)

Discover related pathways, diseases and genes to BICD1 Antibody (NBP1-85843). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BICD1 Antibody (NBP1-85843)

Discover more about diseases related to BICD1 Antibody (NBP1-85843).
 

Pathways for BICD1 Antibody (NBP1-85843)

View related products by pathway.

PTMs for BICD1 Antibody (NBP1-85843)

Learn more about PTMs related to BICD1 Antibody (NBP1-85843).

Blogs on BICD1

There are no specific blogs for BICD1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BICD1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol BICD1