BICC1 Antibody

Images

 
Orthogonal Strategies: Western Blot: BICC1 Antibody [NBP1-94171] - Analysis in human cell lines Caco-2 and A-431 using anti-BICC1 antibody. Corresponding BICC1 RNA-seq data are presented for the same cell lines. ...read more
Immunocytochemistry/ Immunofluorescence: BICC1 Antibody [NBP1-94171] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: BICC1 Antibody [NBP1-94171] - Staining of human small intestine shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: BICC1 Antibody [NBP1-94171] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: BICC1 Antibody [NBP1-94171] - Staining of human pancreas shows moderate granular cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: BICC1 Antibody [NBP1-94171] - Staining of human placenta shows moderate granular cytoplasmic positivity.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

BICC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NAGDLKQMMCPSKVSCAKRQTVELLQGTKNSHLHSTDRLLSDPELSATESPLADKKAPGSERAAERAAAAQQNSERAHLAPRSSYVNMQAFDYEQKKLLATKAMLKKPVVTEVRTPTNTWSGLGFSKSMPAETIKELRRA
Specificity
Specificity of human BICC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BICC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BICC1 Antibody

  • bicaudal C homolog 1 (Drosophila)
  • BICC
  • DKFZp686I21119

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-99477
Species: Hu
NBP1-28751
Species: Hu, Mu
Applications: WB, IB, IP
NBP1-58849
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ye, Ze
Applications: WB, IHC, IHC-P
NBP2-24648
Species: Hu, Mu, Rt, Pm
Applications: WB
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85843
Species: Hu
Applications: WB, IHC, IHC-P
AF4340
Species: Hu, Rt
Applications: WB, IHC
AF6278
Species: Hu, Mu
Applications: WB
MAB1567
Species: Hu
Applications: Flow, CyTOF-reported
NBP2-67800
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF
AF1927
Species: Hu
Applications: WB, IP, ICC
NBP1-89081
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF7164
Species: Hu
Applications: WB
NBP1-81488
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00004849-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, KO
NBP1-94171
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for BICC1 Antibody (NBP1-94171) (0)

There are no publications for BICC1 Antibody (NBP1-94171).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BICC1 Antibody (NBP1-94171) (0)

There are no reviews for BICC1 Antibody (NBP1-94171). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BICC1 Antibody (NBP1-94171) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional BICC1 Products

Array NBP1-94171

Bioinformatics Tool for BICC1 Antibody (NBP1-94171)

Discover related pathways, diseases and genes to BICC1 Antibody (NBP1-94171). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BICC1 Antibody (NBP1-94171)

Discover more about diseases related to BICC1 Antibody (NBP1-94171).
 

Pathways for BICC1 Antibody (NBP1-94171)

View related products by pathway.

Blogs on BICC1

There are no specific blogs for BICC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BICC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BICC1