ANKS6 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ANKS6 Antibody [NBP1-89081] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli fibrillar center.
Immunohistochemistry-Paraffin: ANKS6 Antibody [NBP1-89081] - Staining of human cerebral cortex shows strong cytoplasmic positivity in granular pattern in neuronal cells.

Product Details

Summary
Reactivity Hu, Ze, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ANKS6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TSTTSKSTSPTLTPSPSPKGHTAESSVSSSSSHRQSKSSGGSSSGTITDEDELTGILKKLSLEKYQPIFEEQEVDMEAFLTLTDGDLKELGIKTDGSRQQILAAISELNAGKGRERQILQETIHNFHSSF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANKS6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ANKS6 Protein (NBP1-89081PEP)
Publications
Read Publications using
NBP1-89081 in the following applications:

  • IHC
    3 publications
  • WB
    1 publication

Reactivity Notes

Zebrafish reactivity reported in scientific literature (PMID: 23793029).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ANKS6 Antibody

  • ANKRD14
  • ankyrin repeat and SAM domain-containing protein 6
  • ankyrin repeat and sterile alpha motif domain containing 6
  • ankyrin repeat domain 14
  • Ankyrin repeat domain-containing protein 14
  • DKFZp686D24121
  • DKFZp781I0117
  • FLJ36928
  • MGC70366
  • SAM domain-containing protein 6
  • samCystin
  • SAMD6
  • sterile alpha motif domain containing 6
  • Sterile alpha motif domain-containing protein 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB4280
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-02984
Species: Hu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6270
Species: Hu
Applications: ICC
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-94171
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
PP-H4537-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
H00002618-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
NBP2-29942
Species: Hu
Applications: WB, Flow, IHC-P
AF5269
Species: Hu, Mu
Applications: WB, IHC
NB400-157
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western
NBP1-51911
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-89081
Species: Hu, Ze, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for ANKS6 Antibody (NBP1-89081)(3)

We have publications tested in 4 confirmed species: Human, Mouse, Rat, Zebrafish.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(3)
WB
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
Rat
(1)
Zebrafish
(1)
All Species

Reviews for ANKS6 Antibody (NBP1-89081) (0)

There are no reviews for ANKS6 Antibody (NBP1-89081). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ANKS6 Antibody (NBP1-89081) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ANKS6 Products

ANKS6 NBP1-89081

Bioinformatics Tool for ANKS6 Antibody (NBP1-89081)

Discover related pathways, diseases and genes to ANKS6 Antibody (NBP1-89081). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ANKS6 Antibody (NBP1-89081)

Discover more about diseases related to ANKS6 Antibody (NBP1-89081).
 

Pathways for ANKS6 Antibody (NBP1-89081)

View related products by pathway.

Research Areas for ANKS6 Antibody (NBP1-89081)

Find related products by research area.

Blogs on ANKS6

There are no specific blogs for ANKS6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ANKS6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANKS6
Entrez
Uniprot