BHMT Antibody


Western Blot: BHMT Antibody [NBP1-88611] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane more
Immunocytochemistry/ Immunofluorescence: BHMT Antibody [NBP1-88611] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: BHMT Antibody [NBP1-88611] - Staining in human kidney and lymph node tissues using anti-BHMT antibody. Corresponding BHMT RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: BHMT Antibody [NBP1-88611] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: BHMT Antibody [NBP1-88611] - Staining of human lymph node shows low expression as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

BHMT Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: YASEDKLENRGNYVLEKISGQEVNEAACDIARQVADEGDALVAGGVSQTPSYLSCKSETEVKKVFLQQLEVFIKKNVD
Specificity of human BHMT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BHMT Protein (NBP1-88611PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for BHMT Antibody

  • betaine homocysteine methyltransferase
  • betaine-homocysteine methyltransferase
  • betaine--homocysteine S-methyltransferase 1
  • betaine--homocysteine S-methyltransferase
  • BHMT1
  • EC 2.1.1
  • EC


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, IP, RNAi
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, IHC
Species: Hu, Rt
Applications: WB, ELISA, IHC
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq, Gt, GP, Rb
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC

Publications for BHMT Antibody (NBP1-88611) (0)

There are no publications for BHMT Antibody (NBP1-88611).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BHMT Antibody (NBP1-88611) (0)

There are no reviews for BHMT Antibody (NBP1-88611). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BHMT Antibody (NBP1-88611) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional BHMT Products

Bioinformatics Tool for BHMT Antibody (NBP1-88611)

Discover related pathways, diseases and genes to BHMT Antibody (NBP1-88611). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BHMT Antibody (NBP1-88611)

Discover more about diseases related to BHMT Antibody (NBP1-88611).

Pathways for BHMT Antibody (NBP1-88611)

View related products by pathway.

PTMs for BHMT Antibody (NBP1-88611)

Learn more about PTMs related to BHMT Antibody (NBP1-88611).

Blogs on BHMT

There are no specific blogs for BHMT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our BHMT Antibody and receive a gift card or discount.


Gene Symbol BHMT