BHMT2 Antibody


Western Blot: BHMT2 Antibody [NBP1-85826] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate
Immunocytochemistry/ Immunofluorescence: BHMT2 Antibody [NBP1-85826] - Staining of human cell line U-2 OS shows positivity in plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: BHMT2 Antibody [NBP1-85826] - Staining in human kidney and lymph node tissues using anti-BHMT2 antibody. Corresponding BHMT2 RNA-seq data are presented for the same tissues.
Western Blot: BHMT2 Antibody [NBP1-85826] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane more
Immunohistochemistry-Paraffin: BHMT2 Antibody [NBP1-85826] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: BHMT2 Antibody [NBP1-85826] - Staining of human lymph node shows low expression as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

BHMT2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: FTFSASEDNMESKWEDVNAAACDLAREVAGKGDALVAGGICQTSIYKYQKDEA
Specificity of human, mouse, rat BHMT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BHMT2 Protein (NBP1-85826PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (81%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for BHMT2 Antibody

  • betaine-homocysteine methyltransferase 2
  • betaine--homocysteine S-methyltransferase 2
  • EC
  • FLJ20001


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, IP, RNAi
Species: Hu, Rt
Applications: WB, ELISA, IHC
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for BHMT2 Antibody (NBP1-85826) (0)

There are no publications for BHMT2 Antibody (NBP1-85826).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BHMT2 Antibody (NBP1-85826) (0)

There are no reviews for BHMT2 Antibody (NBP1-85826). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BHMT2 Antibody (NBP1-85826). (Showing 1 - 1 of 1 FAQ).

  1. I was looking at the BHMT2 antibody IHC image in brain tissue and I want to know where is this protein expressed? Cytosolic or nuclear ? the image you are showing does not have details.
    • BHMT2 protein is not a very well published target and I do not see any research paper with its immuno-staining data. However, our antibodies NBP1-85826 and NBP2-15585 depicted a strong cytoplasmic staining with mild nuclear positivity for this target in IHC-P and ICC-IF assays. Human Protein Atlas also shows mainly cytoplasmic staining in hepatocytes, renal tubules, thyroid gland and a subset of cells in exocrine pancreas. Chadwick et al. (Genomics. 2000 Nov 15;70(1):66-73) reported that BHMT2 is expressed in liver and kidney, and at reduced levels in the brain, heart, and skeletal muscle.

Secondary Antibodies


Isotype Controls

Additional BHMT2 Products

Bioinformatics Tool for BHMT2 Antibody (NBP1-85826)

Discover related pathways, diseases and genes to BHMT2 Antibody (NBP1-85826). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BHMT2 Antibody (NBP1-85826)

Discover more about diseases related to BHMT2 Antibody (NBP1-85826).

Pathways for BHMT2 Antibody (NBP1-85826)

View related products by pathway.

PTMs for BHMT2 Antibody (NBP1-85826)

Learn more about PTMs related to BHMT2 Antibody (NBP1-85826).

Blogs on BHMT2

There are no specific blogs for BHMT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our BHMT2 Antibody and receive a gift card or discount.


Gene Symbol BHMT2