beta-Glucuronidase/GUSB Antibody - BSA Free

Immunohistochemistry-Paraffin: beta-Glucuronidase/GUSB Antibody [NBP2-38293] - Staining of human gallbladder shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

beta-Glucuronidase/GUSB Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit beta-Glucuronidase/GUSB Antibody - BSA Free (NBP2-38293) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TSHYPYAEEVMQMCDRYGIVVIDECPGVGLALPQFFNNVSLHHHMQVMEEVVRRDKNHPAVVMWSVANEPASHLESAGYYLKMV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GUSB
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  beta-Glucuronidase/GUSB Protein (NBP2-38293PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for beta-Glucuronidase/GUSB Antibody - BSA Free

• beta-D-glucuronidase
• Beta-G1
• beta-glucuronidase
• BG
• EC 3.2.1.31
• FLJ39445
• glucuronidase, beta
• GUSB
• MPS7

Background

The GUSB gene encodes beta-glucuronidase (EC 3.2.1.31), a lysosomal hydrolase involved in the stepwise degradation of glucuronic acid-containing glycosaminoglycans (Shipley et al., 1993 [PubMed 7680524]). It is a tetrameric glycoprotein composed of identical subunits (Oshima et al., 1987 [PubMed 3468507]). The GUSB gene is mutated in mucopolysaccharidosis type VII (MPS7; MIM 253220).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GUSB
• Uniprot:
  • P08236(Human)