beta Adducin Antibody

Images

 
Western Blot: beta Adducin Antibody [NBP2-33974] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: beta Adducin Antibody [NBP2-33974] - Staining in human cerebral cortex and pancreas tissues using anti-ADD2 antibody. Corresponding ADD2 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: beta Adducin Antibody [NBP2-33974] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: beta Adducin Antibody [NBP2-33974] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

beta Adducin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NNSSNIWALRQIADFMASTSHAVFPTSSMNVSMMTPINDLHTADSLNLAKGERLMRCKISSVYRLLDLYGWAQLSDTYVTLRVSKEQDHF
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Simple Western
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
beta Adducin Protein (NBP2-33974PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for beta Adducin Antibody

  • ADDBErythrocyte adducin subunit beta
  • adducin 2 (beta)
  • beta adducin
  • beta-adducin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38268
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34017
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF-252-PB
Species: Hu
Applications: IHC, WB
NB500-517
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-148
Species: Ce, Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
NB300-543
Species: Am, Bv, Ca, Ma, Fi, Hu, Ma-Mn, Mu, Pm, Rb, Rt, Sh
Applications: B/N, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MAB2688
Species: Hu
Applications: WB
MAB1228
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP
NBP1-31133
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88370
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-14871
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBL1-11414
Species: Hu
Applications: WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB
H00002316-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB
NBP1-81524
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-76919
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-15365
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

Publications for beta Adducin Antibody (NBP2-33974) (0)

There are no publications for beta Adducin Antibody (NBP2-33974).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for beta Adducin Antibody (NBP2-33974) (0)

There are no reviews for beta Adducin Antibody (NBP2-33974). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for beta Adducin Antibody (NBP2-33974) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional beta Adducin Products

Bioinformatics Tool for beta Adducin Antibody (NBP2-33974)

Discover related pathways, diseases and genes to beta Adducin Antibody (NBP2-33974). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for beta Adducin Antibody (NBP2-33974)

Discover more about diseases related to beta Adducin Antibody (NBP2-33974).
 

Pathways for beta Adducin Antibody (NBP2-33974)

View related products by pathway.

PTMs for beta Adducin Antibody (NBP2-33974)

Learn more about PTMs related to beta Adducin Antibody (NBP2-33974).
 

Research Areas for beta Adducin Antibody (NBP2-33974)

Find related products by research area.

Blogs on beta Adducin

There are no specific blogs for beta Adducin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our beta Adducin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADD2
Uniprot