beta Adducin Antibody - BSA Free

Western Blot: beta Adducin Antibody [NBP2-33974] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunohistochemistry-Paraffin: beta Adducin Antibody [NBP2-33974] - Staining in human cerebral cortex and pancreas tissues using anti-ADD2 antibody. Corresponding ADD2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: beta Adducin Antibody [NBP2-33974] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: beta Adducin Antibody [NBP2-33974] - Staining of human pancreas shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

beta Adducin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit beta Adducin Antibody - BSA Free (NBP2-33974) is a polyclonal antibody validated for use in IHC, WB and Simple Western. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NNSSNIWALRQIADFMASTSHAVFPTSSMNVSMMTPINDLHTADSLNLAKGERLMRCKISSVYRLLDLYGWAQLSDTYVTLRVSKEQDHF
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADD2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Simple Western
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. See Simple Western Antibody Database for Simple Western validation: Separated by size; matrix was 12-230 kDa; detected by Chemiluminescence.
• Control Peptide:

  beta Adducin Protein (NBP2-33974PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for beta Adducin Antibody - BSA Free

• ADDBErythrocyte adducin subunit beta
• adducin 2 (beta)
• beta adducin
• beta-adducin

Background

Adducins are a family of cytoskeleton proteins encoded by three genes (alpha, beta and gamma). Adducin is a protein associated with the inner leaflet of the plasma membrane and is one of the proteins localized at the spectrin-actin junction of the membrane skeleton. The cortical actin cytoskeletal network is lost during apoptosis and adducins are central in the cortical actin network organization. Adducin alpha is a cytoskeletal protein involved with sodium-pump activity in the renal tubule and is associated with hypertension. The expression of Adducin alpha and Adducin gamma is ubiquitous in contrast to the restricted expression of Adducin beta. Adducin beta is expressed at high levels in brain and hematopoietic tissues, such as bone marrow in humans, and spleen in mice.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADD2
• Uniprot:
  • P35612(Human)