gamma Adducin Antibody - BSA Free

Western Blot: gamma Adducin Antibody [NBP2-34017] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-229

Immunocytochemistry/Immunofluorescence: gamma Adducin Antibody [NBP2-34017] - Staining of human cell line HEK 293 shows localization to plasma membrane.

Immunohistochemistry-Paraffin: gamma Adducin Antibody [NBP2-34017] - Staining of human testis shows strong membranous positivity in cells in seminiferous ducts.

Immunohistochemistry: gamma Adducin Antibody [NBP2-34017] - Staining of human stomach, lower shows strong cytoplasmic and membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: gamma Adducin Antibody [NBP2-34017] - Analysis in human cerebral cortex and skeletal muscle tissues using NBP2-34017 antibody. Corresponding ADD3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: gamma Adducin Antibody [NBP2-34017] - Staining of human cerebral cortex shows strong positivity in neuropil and glial cells.

Immunohistochemistry-Paraffin: gamma Adducin Antibody [NBP2-34017] - Staining of human duodenum shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: gamma Adducin Antibody [NBP2-34017] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

gamma Adducin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit gamma Adducin Antibody - BSA Free (NBP2-34017) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ASSVSQIQSQTQSPQNVPEKLEENHELFSKSFISMEVPVMVVNGKDDMHDVEDELAKRVSRLSTSTTIENIEITIKSPEKIEEVLSPE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADD3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  gamma Adducin Protein (NBP2-34017PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for gamma Adducin Antibody - BSA Free

• ADDLAdducin-like protein 70
• adducin 3 (gamma)
• gamma-adducin

Background

Adducins are a family of cytoskeleton proteins encoded by three genes (alpha, beta and gamma). Adducin is a protein associated with the inner leaflet of the plasma membrane and is one of the proteins localized at the spectrin-actin junction of the membrane skeleton. The cortical actin cytoskeletal network is lost during apoptosis and adducins are central in the cortical actin network organization. Adducin alpha is a cytoskeletal protein involved with sodium-pump activity in the renal tubule and is associated with hypertension. The expression of Adducin alpha and Adducin gamma is ubiquitous in contrast to the restricted expression of Adducin beta. Adducin beta is expressed at high levels in brain and hematopoietic tissues, such as bone marrow in humans, and spleen in mice.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADD3
• Uniprot:
  • Q9UEY8(Human)