gamma Adducin Antibody

Images

 
Western Blot: gamma Adducin Antibody [NBP2-34017] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-229
Immunocytochemistry/ Immunofluorescence: gamma Adducin Antibody [NBP2-34017] - Staining of human cell line HEK 293 shows localization to plasma membrane.
Immunohistochemistry-Paraffin: gamma Adducin Antibody [NBP2-34017] - Staining of human testis shows strong membranous positivity in cells in seminiferous ducts.
Immunohistochemistry: gamma Adducin Antibody [NBP2-34017] - Staining of human stomach, lower shows strong cytoplasmic and membranous positivity in glandular cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: gamma Adducin Antibody [NBP2-34017] - Analysis in human cerebral cortex and skeletal muscle tissues using NBP2-34017 antibody. Corresponding ADD3 RNA-seq data ...read more
Immunohistochemistry-Paraffin: gamma Adducin Antibody [NBP2-34017] - Staining of human cerebral cortex shows strong positivity in neuropil and glial cells.
Immunohistochemistry-Paraffin: gamma Adducin Antibody [NBP2-34017] - Staining of human duodenum shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: gamma Adducin Antibody [NBP2-34017] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

gamma Adducin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ASSVSQIQSQTQSPQNVPEKLEENHELFSKSFISMEVPVMVVNGKDDMHDVEDELAKRVSRLSTSTTIENIEITIKSPEKIEEVLSPE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADD3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
gamma Adducin Protein (NBP2-34017PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for gamma Adducin Antibody

  • ADDLAdducin-like protein 70
  • adducin 3 (gamma)
  • gamma-adducin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38268
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33974
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt, Ba, Pm
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-12793
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
NBP1-88370
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-87027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-93325
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-34017
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45041
Species: Hu, Po
Applications: Flow, ICC/IF, IF
NB100-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, KD
AF3587
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
NBP2-67667
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-82026
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for gamma Adducin Antibody (NBP2-34017) (0)

There are no publications for gamma Adducin Antibody (NBP2-34017).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for gamma Adducin Antibody (NBP2-34017) (0)

There are no reviews for gamma Adducin Antibody (NBP2-34017). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for gamma Adducin Antibody (NBP2-34017) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional gamma Adducin Products

Bioinformatics Tool for gamma Adducin Antibody (NBP2-34017)

Discover related pathways, diseases and genes to gamma Adducin Antibody (NBP2-34017). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for gamma Adducin Antibody (NBP2-34017)

Discover more about diseases related to gamma Adducin Antibody (NBP2-34017).
 

Pathways for gamma Adducin Antibody (NBP2-34017)

View related products by pathway.

PTMs for gamma Adducin Antibody (NBP2-34017)

Learn more about PTMs related to gamma Adducin Antibody (NBP2-34017).

Blogs on gamma Adducin

There are no specific blogs for gamma Adducin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our gamma Adducin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADD3
Uniprot