Bestrophin 1 Recombinant Protein Antigen

Images

 
There are currently no images for Bestrophin 1 Recombinant Protein Antigen (NBP2-56225PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Bestrophin 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Bestrophin 1.

Source: E. coli

Amino Acid Sequence: SQVRRKTVEFNLTDMPEIPENHLKEPLEQSPTNIHTTLKDHMDPYWALENRSVLHLNQGHCIALCPTPASLALSLPFLHNFLGFHHCQSTLDLRPALAWGIYLATFTGILGKCSGPFLTSPWYHPEDFLGPGE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BEST1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56225.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Bestrophin 1 Recombinant Protein Antigen

  • ARB
  • Best disease
  • BEST
  • bestrophin 1
  • bestrophin-1
  • BMD
  • TU15B
  • vitelliform macular dystrophy 2
  • Vitelliform macular dystrophy protein 2
  • VMD2RP50

Background

Bestrophin 1 (BEST1) is a member of the bestrophin family of anion channels. Bestrophins are transmembrane (TM) proteins that share a homology region containing a high content of aromatic residues, including an invariant arg-phe-pro (RFP) motif. Bestrophins are believed to function as chloride channels.

Bestrophin-1, also known as best macular dystrophy (BMD) or vitelliform macular dystrophy (VMD2), is an inherited autosomal form of macular degeneration, characterized by a depressed light peak in the electrooculogram (EOG). Bestrophin 1 is a 68 kDa basolateral plasma membrane protein encoded by the VMD2 gene. Bestrophin 1's function is still unknown, but data suggests that it is a chloride channel that plays a role in generating the altered EOG in Best disease patients. In addition, Bestrophin-1 is a useful biochemical and histological marker of RPE (retinal pigment epithelial cells) cells.

Bestrophin antibodies are useful tools for studies involving vision and retinal disease. .

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
MAB7665
Species: Hu
Applications: IHC, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
291-G1
Species: Hu
Applications: BA
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
DY805
Species: Hu
Applications: ELISA
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-02623
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
462-TEC
Species: Mu
Applications: BA
M6000B
Species: Mu
Applications: ELISA
DPI00
Species: Hu
Applications: ELISA
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
NBP2-92749
Species: Hu, Mu
Applications: WB

Publications for Bestrophin 1 Recombinant Protein Antigen (NBP2-56225PEP) (0)

There are no publications for Bestrophin 1 Recombinant Protein Antigen (NBP2-56225PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Bestrophin 1 Recombinant Protein Antigen (NBP2-56225PEP) (0)

There are no reviews for Bestrophin 1 Recombinant Protein Antigen (NBP2-56225PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Bestrophin 1 Recombinant Protein Antigen (NBP2-56225PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Bestrophin 1 Products

Research Areas for Bestrophin 1 Recombinant Protein Antigen (NBP2-56225PEP)

Find related products by research area.

Blogs on Bestrophin 1.

Vision Infographic: Do you see how I see?
Vision involves several parts of the eye processing light which send signals to the brain via the optic nerve to process information. Learn more about the vision process and related ocular proteins in the infographic below. Novus Biological...  Read full blog post.

Bestrophin 1: Implications in Progressive Vision Loss
The human Bestrophin family has four members, Best1, Best2, Best3 and Best4. These transmembrane proteins can function as chloride channels, and can also regulate calcium channels (1). The Bestrophins all have a conserved domain which begins at the N-...  Read full blog post.

"I can see clearly now": Targeting Bestrophin 1 to treat Bestrophinopathies
Encoded by the VMD2 gene on chromosome 11q13 Bestrophin 1 is the prototypic member of the RFP family of proteins which are more commonly called "bestrophins". The protein family was originally identified in Caenorhabditis elegans based on a conserved ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Bestrophin 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BEST1