Bestrophin 1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Bestrophin 1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Bestrophin 1.

  Source: E. coli

  Amino Acid Sequence: SQVRRKTVEFNLTDMPEIPENHLKEPLEQSPTNIHTTLKDHMDPYWALENRSVLHLNQGHCIALCPTPASLALSLPFLHNFLGFHHCQSTLDLRPALAWGIYLATFTGILGKCSGPFLTSPWYHPEDFLGPGE

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: BEST1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56225.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 33 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Bestrophin 1 Recombinant Protein Antigen

• ARB
• Best disease
• BEST
• bestrophin 1
• bestrophin-1
• BMD
• TU15B
• vitelliform macular dystrophy 2
• Vitelliform macular dystrophy protein 2
• VMD2RP50

Background

Bestrophin 1 (BEST1) is a member of the bestrophin family of anion channels. Bestrophins are transmembrane (TM) proteins that share a homology region containing a high content of aromatic residues, including an invariant arg-phe-pro (RFP) motif. Bestrophins are believed to function as chloride channels.

Bestrophin-1, also known as best macular dystrophy (BMD) or vitelliform macular dystrophy (VMD2), is an inherited autosomal form of macular degeneration, characterized by a depressed light peak in the electrooculogram (EOG). Bestrophin 1 is a 68 kDa basolateral plasma membrane protein encoded by the VMD2 gene. Bestrophin 1's function is still unknown, but data suggests that it is a chloride channel that plays a role in generating the altered EOG in Best disease patients. In addition, Bestrophin-1 is a useful biochemical and histological marker of RPE (retinal pigment epithelial cells) cells.

Bestrophin antibodies are useful tools for studies involving vision and retinal disease. .

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: BEST1