BEN Domain Containing 5 Antibody


Western Blot: BEN Domain Containing 5 Antibody [NBP2-31701] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma more
Immunohistochemistry: BEN Domain Containing 5 Antibody [NBP2-31701] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

BEN Domain Containing 5 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: DLQLRHIKRPEGRKPSEVAHKSIEAVVARLEKQNGLSLGHSTCPEEVFVEASPGTEDMDSLEDAVVPRALYEELLRNYQQQQE
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (96%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BEN Domain Containing 5 Protein (NBP2-31701PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for BEN Domain Containing 5 Antibody

  • BEN domain containing 5
  • BEN Domain-Containing Protein 5
  • BEND5
  • C1orf165
  • chromosome 1 open reading frame 165
  • FLJ11588


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
Species: Mu
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for BEN Domain Containing 5 Antibody (NBP2-31701) (0)

There are no publications for BEN Domain Containing 5 Antibody (NBP2-31701).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BEN Domain Containing 5 Antibody (NBP2-31701) (0)

There are no reviews for BEN Domain Containing 5 Antibody (NBP2-31701). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BEN Domain Containing 5 Antibody (NBP2-31701) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional BEN Domain Containing 5 Products

Bioinformatics Tool for BEN Domain Containing 5 Antibody (NBP2-31701)

Discover related pathways, diseases and genes to BEN Domain Containing 5 Antibody (NBP2-31701). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BEN Domain Containing 5 Antibody (NBP2-31701)

Discover more about diseases related to BEN Domain Containing 5 Antibody (NBP2-31701).

Pathways for BEN Domain Containing 5 Antibody (NBP2-31701)

View related products by pathway.

Blogs on BEN Domain Containing 5

There are no specific blogs for BEN Domain Containing 5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our BEN Domain Containing 5 Antibody and receive a gift card or discount.


Gene Symbol BEND5