BDH2 Antibody

Images

 
Immunohistochemistry-Paraffin: BDH2 Antibody [NBP1-85218] - Staining of human duodenum shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BDH2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CPGTVDTPSLQERIQARGNPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIIDGGWSL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BDH2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BDH2 Protein (NBP1-85218PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BDH2 Antibody

  • 3-hydroxybutyrate dehydrogenase, type 2
  • dehydrogenase/reductase (SDR family) member 6
  • Dehydrogenase/reductase SDR family member 6
  • DHRS6
  • EC 1.1.1.-
  • EC 1.1.1.30
  • EFA6R
  • FLJ13261
  • Oxidoreductase UCPA
  • PRO20933
  • R-beta-hydroxybutyrate dehydrogenase
  • SDR15C1,3-hydroxybutyrate dehydrogenase type 2
  • short chain dehydrogenase/reductase family 15C, member 1
  • UCPA-OR
  • UNQ6308

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88673
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1857
Species: Mu
Applications: WB, Simple Western, IP
NBP2-30589
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87283
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-55339
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-54778
Species: Hu
Applications: WB, IHC
NBP1-86792
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90174
Species: Hu
Applications: IHC, IHC-P
AF877
Species: Hu
Applications: WB, IHC, IP
NBP1-81734
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56537
Species: Hu, Mu
Applications: WB, ChIP, IP
NBP2-13541
Species: Hu, Mu
Applications: Simple Western, IHC, IHC-P
NBP1-84212
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-38088
Species: Hu
Applications: IHC, IHC-P
NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56150
Species: Hu, Rt, Po, Ch, Xp, Mu(-)
Applications: WB, IHC, IHC-P, IP
NBP1-85218
Species: Hu
Applications: IHC, IHC-P

Publications for BDH2 Antibody (NBP1-85218) (0)

There are no publications for BDH2 Antibody (NBP1-85218).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BDH2 Antibody (NBP1-85218) (0)

There are no reviews for BDH2 Antibody (NBP1-85218). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BDH2 Antibody (NBP1-85218) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BDH2 Products

Bioinformatics Tool for BDH2 Antibody (NBP1-85218)

Discover related pathways, diseases and genes to BDH2 Antibody (NBP1-85218). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BDH2 Antibody (NBP1-85218)

Discover more about diseases related to BDH2 Antibody (NBP1-85218).
 

Pathways for BDH2 Antibody (NBP1-85218)

View related products by pathway.

PTMs for BDH2 Antibody (NBP1-85218)

Learn more about PTMs related to BDH2 Antibody (NBP1-85218).
 

Research Areas for BDH2 Antibody (NBP1-85218)

Find related products by research area.

Blogs on BDH2

There are no specific blogs for BDH2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BDH2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BDH2