ATPase Na+/K+ beta 2 Antibody

Images

 
Immunohistochemistry: ATPase Na+/K+ beta 2 Antibody [NBP1-90174] - Staining of human hippocampus shows distinct positivity in neuropil.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATPase Na+/K+ beta 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TVSDHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDST
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP1B2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ATPase Na+/K+ beta 2 Protein (NBP1-90174PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATPase Na+/K+ beta 2 Antibody

  • adhesion molecule on glia
  • AMOGsodium/potassium-dependent ATPase beta-2 subunit
  • ATPase, Na+/K+ transporting, beta 2 polypeptide
  • Na, K-ATPase beta-2 polypeptide
  • Sodium/potassium-dependent ATPase subunit beta-2
  • sodium/potassium-transporting ATPase beta-2 chain
  • sodium/potassium-transporting ATPase subunit beta-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80104
Species: Hu
Applications: WB
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
MAB3426
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-55339
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30589
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13545
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ATPase Na+/K+ beta 2 Antibody (NBP1-90174) (0)

There are no publications for ATPase Na+/K+ beta 2 Antibody (NBP1-90174).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATPase Na+/K+ beta 2 Antibody (NBP1-90174) (0)

There are no reviews for ATPase Na+/K+ beta 2 Antibody (NBP1-90174). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ATPase Na+/K+ beta 2 Antibody (NBP1-90174) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATPase Na+/K+ beta 2 Products

Bioinformatics Tool for ATPase Na+/K+ beta 2 Antibody (NBP1-90174)

Discover related pathways, diseases and genes to ATPase Na+/K+ beta 2 Antibody (NBP1-90174). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATPase Na+/K+ beta 2 Antibody (NBP1-90174)

Discover more about diseases related to ATPase Na+/K+ beta 2 Antibody (NBP1-90174).
 

Pathways for ATPase Na+/K+ beta 2 Antibody (NBP1-90174)

View related products by pathway.

PTMs for ATPase Na+/K+ beta 2 Antibody (NBP1-90174)

Learn more about PTMs related to ATPase Na+/K+ beta 2 Antibody (NBP1-90174).

Blogs on ATPase Na+/K+ beta 2

There are no specific blogs for ATPase Na+/K+ beta 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATPase Na /K beta 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP1B2