BCL6B Antibody

Images

 
Western Blot: BCL6B Antibody [NBP1-80434] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BCL6B Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human BCL6B. Peptide sequence LQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BCL6B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against BCL6B and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for BCL6B Antibody

  • BAZFBcl6-associated zinc finger protein
  • B-cell CLL/lymphoma 6 member B protein
  • B-cell CLL/lymphoma 6, member B (zinc finger protein)
  • B-cell CLL/lymphoma 6, member B
  • ZBTB28
  • Zinc finger protein 62ZNF62

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31369
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01926
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-14950
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF800
Species: Hu, Mu
Applications: WB, Simple Western, IP
NBP1-33427
Species: Hu
Applications: WB, ICC/IF, ChIP
AF2944
Species: Hu
Applications: WB, Simple Western
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
AF482
Species: Mu
Applications: WB, IHC
NBP2-57362
Species: Hu
Applications: WB, ICC/IF
6507-IL/CF
Species: Hu
NBP1-80434
Species: Hu
Applications: WB

Publications for BCL6B Antibody (NBP1-80434) (0)

There are no publications for BCL6B Antibody (NBP1-80434).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BCL6B Antibody (NBP1-80434) (0)

There are no reviews for BCL6B Antibody (NBP1-80434). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BCL6B Antibody (NBP1-80434) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for BCL6B Antibody (NBP1-80434)

Discover related pathways, diseases and genes to BCL6B Antibody (NBP1-80434). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BCL6B Antibody (NBP1-80434)

Discover more about diseases related to BCL6B Antibody (NBP1-80434).
 

Pathways for BCL6B Antibody (NBP1-80434)

View related products by pathway.

PTMs for BCL6B Antibody (NBP1-80434)

Learn more about PTMs related to BCL6B Antibody (NBP1-80434).

Blogs on BCL6B

There are no specific blogs for BCL6B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BCL6B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BCL6B
Uniprot