BCL6B Antibody


Western Blot: BCL6B Antibody [NBP1-80434] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

BCL6B Antibody Summary

Synthetic peptide directed towards the middle region of human BCL6B. Peptide sequence LQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against BCL6B and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for BCL6B Antibody

  • BAZFBcl6-associated zinc finger protein
  • B-cell CLL/lymphoma 6 member B protein
  • B-cell CLL/lymphoma 6, member B (zinc finger protein)
  • B-cell CLL/lymphoma 6, member B
  • ZBTB28
  • Zinc finger protein 62ZNF62


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, Simple Western
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB

Publications for BCL6B Antibody (NBP1-80434) (0)

There are no publications for BCL6B Antibody (NBP1-80434).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BCL6B Antibody (NBP1-80434) (0)

There are no reviews for BCL6B Antibody (NBP1-80434). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BCL6B Antibody (NBP1-80434) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for BCL6B Antibody (NBP1-80434)

Discover related pathways, diseases and genes to BCL6B Antibody (NBP1-80434). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BCL6B Antibody (NBP1-80434)

Discover more about diseases related to BCL6B Antibody (NBP1-80434).

Pathways for BCL6B Antibody (NBP1-80434)

View related products by pathway.

PTMs for BCL6B Antibody (NBP1-80434)

Learn more about PTMs related to BCL6B Antibody (NBP1-80434).

Blogs on BCL6B

There are no specific blogs for BCL6B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our BCL6B Antibody and receive a gift card or discount.


Gene Symbol BCL6B