BCL2L10 Antibody (1B11)

Images

 
Western Blot: BCL2L10 Antibody (1B11) [H00010017-M03] - Analysis of BCL2L10 expression in transfected 293T cell line by BCL2L10 monoclonal antibody (M03), clone 1B11. Lane 1: BCL2L10 transfected lysatE (23.2 KDa). Lane ...read more
ELISA: BCL2L10 Antibody (1B11) [H00010017-M03] - Detection limit for recombinant GST tagged BCL2L10 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1B11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

BCL2L10 Antibody (1B11) Summary

Immunogen
BCL2L10 (NP_065129, 1 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVDQLRERTTMADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFELVALMADSVLSDSPGP
Specificity
BCL2L10 - BCL2-like 10 (apoptosis facilitator) (1B11)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BCL2L10
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BCL2L10 Antibody (1B11)

  • Apoptosis regulator Bcl-B
  • apoptotic protein NrH
  • bcl2-L-10
  • BCL2-like 10 (apoptosis facilitator)
  • bcl-2-like protein 10
  • BCLB
  • BCL-B
  • Boo
  • Diva
  • MGC129810
  • MGC129811

Background

The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The protein encoded by this gene contains conserved BH4, BH1 and BH2 domains. This protein can interact with other members of BCL-2 protein family including BCL2, BCL2L1/BCL-X(L), and BAX. Overexpression of this gene has been shown to suppress cell apoptosis possibly through the prevention of cytochrome C release from the mitochondria, and thus activating caspase-3 activation. The mouse counterpart of this protein is found to interact with Apaf1 and forms a protein complex with Caspase 9, which suggests the involvement of this protein in APAF1 and CASPASE 9 related apoptotic pathway. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56104
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56074
Species: Hu, Mu, Rt, Ma
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-67460
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, Func, IHC, IHC-Fr
NBP2-61706
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Hrk
WBC013
Species: Hu
NB100-56146
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-76963
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
AF860
Species: Hu, Mu
Applications: WB, Simple Western, IP
NBP2-73857
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF6457
Species: Hu
Applications: WB
NBP1-89342
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-73859
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC
AF6067
Species: Hu, Mu, Rt
Applications: WB
NB100-56118
Species: Hu, Mu, Rt, Ca, Ma
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-56370
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56080
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-67563
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
H00010017-M03
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for BCL2L10 Antibody (H00010017-M03) (0)

There are no publications for BCL2L10 Antibody (H00010017-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BCL2L10 Antibody (H00010017-M03) (0)

There are no reviews for BCL2L10 Antibody (H00010017-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BCL2L10 Antibody (H00010017-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional BCL2L10 Products

Bioinformatics Tool for BCL2L10 Antibody (H00010017-M03)

Discover related pathways, diseases and genes to BCL2L10 Antibody (H00010017-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BCL2L10 Antibody (H00010017-M03)

Discover more about diseases related to BCL2L10 Antibody (H00010017-M03).
 

Pathways for BCL2L10 Antibody (H00010017-M03)

View related products by pathway.

PTMs for BCL2L10 Antibody (H00010017-M03)

Learn more about PTMs related to BCL2L10 Antibody (H00010017-M03).
 

Research Areas for BCL2L10 Antibody (H00010017-M03)

Find related products by research area.

Blogs on BCL2L10

There are no specific blogs for BCL2L10, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BCL2L10 Antibody (1B11) and receive a gift card or discount.

Bioinformatics

Gene Symbol BCL2L10
Entrez
Uniprot