BCL2L10 Antibody (1B11) - Azide and BSA Free

Western Blot: BCL2L10 Antibody (1B11) [H00010017-M03] - Analysis of BCL2L10 expression in transfected 293T cell line by BCL2L10 monoclonal antibody (M03), clone 1B11. Lane 1: BCL2L10 transfected lysatE (23.2 KDa). Lane 2: Non-transfected lysate.

ELISA: BCL2L10 Antibody (1B11) [H00010017-M03] - Detection limit for recombinant GST tagged BCL2L10 is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1B11
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

BCL2L10 Antibody (1B11) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse BCL2L10 Antibody (1B11) - Azide and BSA Free (H00010017-M03) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: BCL2L10 (NP_065129, 1 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVDQLRERTTMADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFELVALMADSVLSDSPGP
• Specificity: BCL2L10 - BCL2-like 10 (apoptosis facilitator) (1B11)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: BCL2L10
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BCL2L10 Antibody (1B11) - Azide and BSA Free

• Apoptosis regulator Bcl-B
• apoptotic protein NrH
• BCL2L10
• Bcl2-L-10
• BCL2-like 10 (apoptosis facilitator)
• bcl-2-like protein 10
• BCLB
• BCL-B
• BOO
• DIVA
• MGC129810
• MGC129811

Background

The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The protein encoded by this gene contains conserved BH4, BH1 and BH2 domains. This protein can interact with other members of BCL-2 protein family including BCL2, BCL2L1/BCL-X(L), and BAX. Overexpression of this gene has been shown to suppress cell apoptosis possibly through the prevention of cytochrome C release from the mitochondria, and thus activating caspase-3 activation. The mouse counterpart of this protein is found to interact with Apaf1 and forms a protein complex with Caspase 9, which suggests the involvement of this protein in APAF1 and CASPASE 9 related apoptotic pathway. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BCL2L10
• Entrez:
  • 10017(Human)
• Uniprot:
  • NP_065129(Human)