Bcl-10 Antibody


Western Blot: Bcl10 Antibody [NBP1-85697] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: Bcl10 Antibody [NBP1-85697] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Bcl-10 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRT
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Bcl-10 Protein (NBP1-85697PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Bcl-10 Antibody

  • B-cell CLL/lymphoma 10CIPERCLAPB-cell lymphoma/leukemia 10
  • Bcl10
  • Bcl-10
  • CARD-containing apoptotic signaling protein
  • CARD-containing molecule enhancing NF-kappa-B
  • CARD-containing proapoptotic protein
  • CARD-like apoptotic protein
  • caspase-recruiting domain-containing protein
  • c-E10
  • c-E10bcl-10
  • CED-3/ICH-1 prodomain homologous E10-like regulator
  • Cellular homolog of vCARMEN
  • cellular-E10
  • CLAP
  • hCLAP
  • Mammalian CARD-containing adapter molecule E10
  • mE10
  • mE10CARD containing molecule enhancing NF-kB


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
Species: Hu
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC

Publications for Bcl-10 Antibody (NBP1-85697) (0)

There are no publications for Bcl-10 Antibody (NBP1-85697).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Bcl-10 Antibody (NBP1-85697) (0)

There are no reviews for Bcl-10 Antibody (NBP1-85697). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Bcl-10 Antibody (NBP1-85697) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Bcl-10 Products

Bioinformatics Tool for Bcl-10 Antibody (NBP1-85697)

Discover related pathways, diseases and genes to Bcl-10 Antibody (NBP1-85697). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Bcl-10 Antibody (NBP1-85697)

Discover more about diseases related to Bcl-10 Antibody (NBP1-85697).

Pathways for Bcl-10 Antibody (NBP1-85697)

View related products by pathway.

PTMs for Bcl-10 Antibody (NBP1-85697)

Learn more about PTMs related to Bcl-10 Antibody (NBP1-85697).

Research Areas for Bcl-10 Antibody (NBP1-85697)

Find related products by research area.

Blogs on Bcl-10

There are no specific blogs for Bcl-10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Bcl-10 Antibody and receive a gift card or discount.


Gene Symbol BCL10