BCAT1 Antibody

Images

 
Western Blot: BCAT1 Antibody [NBP1-69020] - Mouse Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BCAT1 Antibody Summary

Immunogen
Synthetic peptides corresponding to Bcat1 (branched chain aminotransferase 1, cytosolic) The peptide sequence was selected from the C terminal of Bcat1. Peptide sequence ACVVCPVSDILYKGQMLHIPTMENGPKLASRILGKLTDIQYGRVESDWTI.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BCAT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Bcat1 and was validated on Western blot.
Theoretical MW
50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for BCAT1 Antibody

  • BCAT(c)
  • BCAT1
  • BCAT-1
  • BCATC
  • BCT1
  • BCT1PNAS121
  • branched chain amino-acid transaminase 1, cytosolic
  • branched chain aminotransferase 1, cytosolic
  • branched-chain-amino-acid aminotransferase, cytosolic
  • DKFZp686E12175
  • EC 2.6.1.42
  • ECA39
  • MECA39
  • placental protein 18
  • PNAS121
  • PP18
  • Protein ECA39

Background

The function of Bcat1 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32652
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-26618
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA
NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-52455
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP1-92409
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-16134
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
35680002
Species: Hu
Applications: WB, ELISA
AF6869
Species: Hu
Applications: WB
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-82493
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-558
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IP
NB120-3535
Species: Hu, Mu, Fi
Applications: WB, ICC/IF, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for BCAT1 Antibody (NBP1-69020) (0)

There are no publications for BCAT1 Antibody (NBP1-69020).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BCAT1 Antibody (NBP1-69020) (0)

There are no reviews for BCAT1 Antibody (NBP1-69020). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BCAT1 Antibody (NBP1-69020) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BCAT1 Products

Bioinformatics Tool for BCAT1 Antibody (NBP1-69020)

Discover related pathways, diseases and genes to BCAT1 Antibody (NBP1-69020). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BCAT1 Antibody (NBP1-69020)

Discover more about diseases related to BCAT1 Antibody (NBP1-69020).
 

Pathways for BCAT1 Antibody (NBP1-69020)

View related products by pathway.

PTMs for BCAT1 Antibody (NBP1-69020)

Learn more about PTMs related to BCAT1 Antibody (NBP1-69020).

Blogs on BCAT1

There are no specific blogs for BCAT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BCAT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BCAT1
Entrez
Uniprot