BBS9 Antibody - Azide and BSA Free Summary
| Immunogen |
BBS9 (AAH32715.1, 1 a.a. - 310 a.a.) full-length human protein. MGYLRIFSPHPAKTGDGAQAEDLLLEVDLRDPVLQVEVGKFVSGTEMLHLAVLHSRKLCVYSVSGTLGNVEHGNQCQMKLMYEHNLQRTACNMTYGSFGGVKGRDLICIQSMDGMLMVFEQESYAFGRFLPGFLLPGPLAYSSRTDSFLTVSSCQQVESYKYQVLAFATDADKRQETEQQKLGSGKRLVVDWTLNIGEQALDICIVSFNQSASSVFVLGERNFFCLKDNGQIRFMKKLDWSPSCFLPYCSVSEGTINTLIGNHNNMLHIYQDVTLKWATQLPHIPVAVRVGCLQFSLWKHLLPRSSTLEK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
BBS9 |
| Purity |
Protein G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This antibody is useful for Western Blot, Functional |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for BBS9 Antibody - Azide and BSA Free
Background
The BBS9 gene is downregulated by parathyroid hormone in osteoblastic cells, and therefore, is thought to be involved inparathyroid hormone action in bones. The exact function of this gene has not yet been determined. Alternativelyspliced transcript variants
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Ha, Hu, Mu, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Publications for BBS9 Antibody (H00027241-D02P) (0)
There are no publications for BBS9 Antibody (H00027241-D02P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for BBS9 Antibody (H00027241-D02P) (0)
There are no reviews for BBS9 Antibody (H00027241-D02P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for BBS9 Antibody (H00027241-D02P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional BBS9 Products
Research Areas for BBS9 Antibody (H00027241-D02P)
Find related products by research area.
|
Blogs on BBS9