BAL/PARP9 Antibody

Images

 
Western Blot: BAL/PARP9 Antibody [NBP2-56376] - Analysis in human cell line RH-30.
Immunocytochemistry/ Immunofluorescence: BAL/PARP9 Antibody [NBP2-56376] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BAL/PARP9 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IDNEVLMAAFQRKKKMMEEKLHRQPVSHRLFQQVPYQFCNVVCRVGFQRMYSTPCDPKYGAGIYFTKNLKNLAEKAKKISAA
Specificity
Specificity of human BAL/PARP9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PARP9
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BAL/PARP9 Recombinant Protein Antigen (NBP2-56376PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for BAL/PARP9 Antibody

  • PARP-9
  • poly (ADP-ribose) polymerase family, member 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-03577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
MAB182
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD
MAB172
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56599
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC
AF4479
Species: Hu
Applications: IHC
NBP1-78984
Species: Hu, Mu
Applications: WB, DB, ICC/IF, IHC, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NBP1-88699
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-59451
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, MiAr
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P

Publications for BAL/PARP9 Antibody (NBP2-56376) (0)

There are no publications for BAL/PARP9 Antibody (NBP2-56376).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAL/PARP9 Antibody (NBP2-56376) (0)

There are no reviews for BAL/PARP9 Antibody (NBP2-56376). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BAL/PARP9 Antibody (NBP2-56376) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional BAL/PARP9 Products

Bioinformatics Tool for BAL/PARP9 Antibody (NBP2-56376)

Discover related pathways, diseases and genes to BAL/PARP9 Antibody (NBP2-56376). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for BAL/PARP9 Antibody (NBP2-56376)

View related products by pathway.

PTMs for BAL/PARP9 Antibody (NBP2-56376)

Learn more about PTMs related to BAL/PARP9 Antibody (NBP2-56376).
 

Research Areas for BAL/PARP9 Antibody (NBP2-56376)

Find related products by research area.

Blogs on BAL/PARP9

There are no specific blogs for BAL/PARP9, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BAL/PARP9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PARP9