BAIAP2L1 Antibody

Western Blot: BAIAP2L1 Antibody [NBP1-89542] - Analysis using Anti-BAIAP2L1 antibody NBP1-89542 (A) shows similar pattern to independent antibody NBP1-89537 (B).

Immunocytochemistry/Immunofluorescence: BAIAP2L1 Antibody [NBP1-89542] - Staining of human cell line U-2 OS shows positivity in plasma membrane and cytoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: BAIAP2L1 Antibody [NBP1-89542] - Staining of human Fallopian tube shows weak cytoplasmic positivity in glandular cells.

Western Blot: BAIAP2L1 Antibody [NBP1-89542] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Western Blot: BAIAP2L1 Antibody [NBP1-89542] - Analysis in human cell lines Caco-2 and U-251MG using anti-BAIAP2L1 antibody. Corresponding BAIAP2L1 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.

Immunohistochemistry-Paraffin: BAIAP2L1 Antibody [NBP1-89542] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: BAIAP2L1 Antibody [NBP1-89542] - Staining of human duodenum shows high expression.

Immunohistochemistry-Paraffin: BAIAP2L1 Antibody [NBP1-89542] - Analysis in human duodenum and skeletal muscle tissues using NBP1-89542 antibody. Corresponding BAIAP2L1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: BAIAP2L1 Antibody [NBP1-89542] - Staining of human prostate shows weak cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: BAIAP2L1 Antibody [NBP1-89542] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

BAIAP2L1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ERSNVVRKDYDTLSKCSPKMPPAPSGRAYTSPLIDMFNNPATAAPNSQRVNNSTGTSEDPSLQRSVSVATGLNMMKKQKVKTIFPHTAGSN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BAIAP2L1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  BAIAP2L1 Protein (NBP1-89542PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for BAIAP2L1 Antibody

• BAI1-associated protein 2-like 1
• BAI1-associated protein 2-like protein 1
• brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1
• FLJ42275
• IRTKSInsulin receptor tyrosine kinase substrate

Background

BAIAP2L1 (Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1) may function as an adapter protein. It contains an IRSp53/MIM homology domain (IMD) that bundles actin filaments, and interacts with the small GTPase Rac.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BAIAP2L1