
Immunohistochemistry: BAFF/BLyS/TNFSF13B Antibody [NBP1-86933] - Staining of human vagina shows strong cytoplasmic, membranous and nuclear positivity in squamous epithelial cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

BAFF/BLyS/TNFSF13B Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: IVGDVALEHTFVTLRKNYRGYNEPDDYSTQWNLVMEKLKCCGVNNYTDFSGSSFEMTTGH
Specificity of human BAFF/BLyS/TNFSF13B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BAFF/BLyS/TNFSF13B Protein (NBP1-86933PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for BAFF/BLyS/TNFSF13B Antibody

  • ApoL related ligand TALL-1
  • B lymphocyte stimulator
  • BAFF
  • BAFFB-cell activating factor
  • B-cell-activating factor
  • BLyS
  • BLYSB-lymphocyte stimulator
  • CD257 antigen
  • CD257
  • Dendritic cell-derived TNF-like molecule
  • DTL
  • TALL1
  • TALL-1delta BAFF
  • TALL1Delta4 BAFF
  • TNF- and APOL-related leukocyte expressed ligand 1
  • TNF and ApoL-related leukocyte expressed ligand 1
  • TNF homolog that activates apoptosis
  • TNFSF13B
  • TNFSF20
  • tumor necrosis factor (ligand) superfamily, member 13b
  • tumor necrosis factor (ligand) superfamily, member 20
  • tumor necrosis factor ligand superfamily member 13B
  • tumor necrosis factor superfamily, member 13b
  • tumor necrosis factor-like protein ZTNF4
  • ZTNF4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
Species: Hu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, Flow
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for BAFF/BLyS/TNFSF13B Antibody (NBP1-86933) (0)

There are no publications for BAFF/BLyS/TNFSF13B Antibody (NBP1-86933).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAFF/BLyS/TNFSF13B Antibody (NBP1-86933) (0)

There are no reviews for BAFF/BLyS/TNFSF13B Antibody (NBP1-86933). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BAFF/BLyS/TNFSF13B Antibody (NBP1-86933) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional BAFF/BLyS/TNFSF13B Products

Bioinformatics Tool for BAFF/BLyS/TNFSF13B Antibody (NBP1-86933)

Discover related pathways, diseases and genes to BAFF/BLyS/TNFSF13B Antibody (NBP1-86933). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BAFF/BLyS/TNFSF13B Antibody (NBP1-86933)

Discover more about diseases related to BAFF/BLyS/TNFSF13B Antibody (NBP1-86933).

Pathways for BAFF/BLyS/TNFSF13B Antibody (NBP1-86933)

View related products by pathway.

PTMs for BAFF/BLyS/TNFSF13B Antibody (NBP1-86933)

Learn more about PTMs related to BAFF/BLyS/TNFSF13B Antibody (NBP1-86933).

Research Areas for BAFF/BLyS/TNFSF13B Antibody (NBP1-86933)

Find related products by research area.


There are no specific blogs for BAFF/BLyS/TNFSF13B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our BAFF/BLyS/TNFSF13B Antibody and receive a gift card or discount.


Gene Symbol TNFSF13B