BAF180/PB1 Recombinant Protein Antigen

Images

 
There are currently no images for BAF180/PB1 Recombinant Protein Antigen (NBP2-30673PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

BAF180/PB1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PBRM1.

Source: E. coli

Amino Acid Sequence: KMEEYDDVNLLTADFQLLFNNAKSYYKPDSPEYKAACKLWDLYLRTRNEFVQKGEADDEDDDEDGQDNQGTVTEGSSPAYLKEILEQLLEAIVVATNPSGRLISELFQKLPSKVQYPDYYAIIKEPIDLKTIAQRIQNGSYKSIHA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PBRM1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-30673.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BAF180/PB1 Recombinant Protein Antigen

  • BAF180
  • BAF180/PB1
  • BAF180PB1BRG1-associated factor 180
  • hPB1
  • MGC156155
  • MGC156156
  • PB1
  • PBRM1
  • polybromo 1
  • Polybromo-1D
  • protein polybromo-1

Background

The SMARCs (SWI/SNF-related, matrix-associated, actin-dependent regulators of chromatin), and BAFs (BRG1-associated factors), have been identified as components of the mammalian SWI/SNF-like chromatin-remodeling protein complexes. These multi-protein complexes are proposed to function as ATP-driven motors that translocate along DNA and destabilize nucleosomal structures to facilitate transcription factor binding. PB1/BAF180 is a component of the SWI/SNF-B (PBAF) complex. It contains six bromodomains which are defined by a 110 amino-acid module that interacts with acetylated lysine and is found in many chromatin binding proteins and histone acetyltransferases. PB1/BAF180 has been proposed to function as a tumor suppressor protein. Recently, PB1/BAF180 has been found to play a role in mediating cell cycle arrest in response to DNA damage via the regulation of the tumor suppressor p21. Alternate names for PB1/BAF180 include protein polybromo-1, polybromo-1D, BRG1-associated factor 180, hPB1, and PBRM1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-01763
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP3-38499
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP3-46899
Species: Hu
Applications: ELISA, ICC/IF, WB
H00002038-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
AF1638
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
NBP1-83180
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF3790
Species: Hu, Mu
Applications: ICC, Simple Western, WB
137-PS
Species: Hu
Applications: BA
H00008878-M01
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-61879
Species: Hu, Mu
Applications: ELISA, Flow, IHC,  IHC-P, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-87466
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-57100
Species: Hu
Applications: ICC/IF
NB100-2594
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-89654
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-30673PEP
Species: Hu
Applications: AC

Publications for BAF180/PB1 Recombinant Protein Antigen (NBP2-30673PEP) (0)

There are no publications for BAF180/PB1 Recombinant Protein Antigen (NBP2-30673PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAF180/PB1 Recombinant Protein Antigen (NBP2-30673PEP) (0)

There are no reviews for BAF180/PB1 Recombinant Protein Antigen (NBP2-30673PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BAF180/PB1 Recombinant Protein Antigen (NBP2-30673PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BAF180/PB1 Products

Research Areas for BAF180/PB1 Recombinant Protein Antigen (NBP2-30673PEP)

Find related products by research area.

Blogs on BAF180/PB1

There are no specific blogs for BAF180/PB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BAF180/PB1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PBRM1