BAF180/PB1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: BAF180/PB1 Antibody [NBP2-55731] - Staining of human cell line RT4 shows localization to nucleoplasm. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BAF180/PB1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PVIQQPTTPMFVAPPPKTQRLLHSEAYLKYIEGLSAESNSISKWDQTLAARRRDVHLSKEQESRLPSHWLKSKGAHTTMADALWRLRDLMLRDTLNIR
Specificity
Specificity of human BAF180/PB1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PBRM1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BAF180/PB1 Recombinant Protein Antigen (NBP2-55731PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for BAF180/PB1 Antibody

  • BAF180PB1BRG1-associated factor 180
  • hPB1
  • MGC156155
  • MGC156156
  • polybromo 1
  • polybromo-1D
  • protein polybromo-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-23368
Species: Hu
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00003845-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
NBP1-83180
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37454
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
H00008878-M01
Species: Hu, Mu, Rt, Bv, Ha, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, S-ELISA
NBP2-61879
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
H00005241-M08
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87466
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-55731
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for BAF180/PB1 Antibody (NBP2-55731) (0)

There are no publications for BAF180/PB1 Antibody (NBP2-55731).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAF180/PB1 Antibody (NBP2-55731) (0)

There are no reviews for BAF180/PB1 Antibody (NBP2-55731). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for BAF180/PB1 Antibody (NBP2-55731) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional BAF180/PB1 Products

Bioinformatics Tool for BAF180/PB1 Antibody (NBP2-55731)

Discover related pathways, diseases and genes to BAF180/PB1 Antibody (NBP2-55731). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BAF180/PB1 Antibody (NBP2-55731)

Discover more about diseases related to BAF180/PB1 Antibody (NBP2-55731).
 

Pathways for BAF180/PB1 Antibody (NBP2-55731)

View related products by pathway.

PTMs for BAF180/PB1 Antibody (NBP2-55731)

Learn more about PTMs related to BAF180/PB1 Antibody (NBP2-55731).

Blogs on BAF180/PB1

There are no specific blogs for BAF180/PB1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BAF180/PB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PBRM1