BAF180/PB1 Antibody (CL0331)

Images

 
Western Blot: BAF180/PB1 Antibody (CL0331) [NBP2-30673] - Analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-PBRM1 antibody. Remaining relative intensity is presented. ...read more
Immunohistochemistry-Paraffin: BAF180/PB1 Antibody (CL0331) [NBP2-30673] - Staining of human liver shows absence of nuclear staining in hepatocytes (negative control).
Western Blot: BAF180/PB1 Antibody (CL0331) [NBP2-30673] - Lane 1: Marker [kDa] Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: BAF180/PB1 Antibody (CL0331) [NBP2-30673] - Staining of human renal cancer shows nuclear immunoreactivity in a subset of cells.
Immunohistochemistry-Paraffin: BAF180/PB1 Antibody (CL0331) [NBP2-30673] - Staining of human breast cancer shows nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: BAF180/PB1 Antibody (CL0331) [NBP2-30673] - Staining of human kidney shows nuclear positivity in both tubules and glomeruli.
Immunohistochemistry-Paraffin: BAF180/PB1 Antibody (CL0331) [NBP2-30673] - Staining of human stomach cancer shows nuclear immunoreactivity in tumor cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clone
CL0331
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

BAF180/PB1 Antibody (CL0331) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KMEEYDDVNLLTADFQLLFNNAKSYYKPDSPEYKAACKLWDLYLRTRNEFVQKGEADDEDDDEDGQDNQGTVTEGSSPAYLKEILEQLLEAIVVATNPSGRLISELFQKLPSKVQYPDYYAIIKEPIDLKTIAQRIQNGSYKSIHA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
PBRM1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for BAF180/PB1 Antibody (CL0331)

  • BAF180PB1BRG1-associated factor 180
  • hPB1
  • MGC156155
  • MGC156156
  • polybromo 1
  • polybromo-1D
  • protein polybromo-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-07799
Species: Hu
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00005554-R02
Species: Hu
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-24567
Species: Hu
Applications: WB
NBP2-54602
Species: Vi
Applications: WB, ELISA, Flow, ICC/IF
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87466
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-57100
Species: Hu
Applications: ICC/IF
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-89655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for BAF180/PB1 Antibody (NBP2-30673) (0)

There are no publications for BAF180/PB1 Antibody (NBP2-30673).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAF180/PB1 Antibody (NBP2-30673) (0)

There are no reviews for BAF180/PB1 Antibody (NBP2-30673). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BAF180/PB1 Antibody (NBP2-30673) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BAF180/PB1 Products

Bioinformatics Tool for BAF180/PB1 Antibody (NBP2-30673)

Discover related pathways, diseases and genes to BAF180/PB1 Antibody (NBP2-30673). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BAF180/PB1 Antibody (NBP2-30673)

Discover more about diseases related to BAF180/PB1 Antibody (NBP2-30673).
 

Pathways for BAF180/PB1 Antibody (NBP2-30673)

View related products by pathway.

PTMs for BAF180/PB1 Antibody (NBP2-30673)

Learn more about PTMs related to BAF180/PB1 Antibody (NBP2-30673).

Blogs on BAF180/PB1

There are no specific blogs for BAF180/PB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BAF180/PB1 Antibody (CL0331) and receive a gift card or discount.

Bioinformatics

Gene Symbol PBRM1
Uniprot