B7-H4 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: B7-H4 Antibody [NBP2-30536] - Immunofluorescent staining of human cell line MCF7 shows localization to plasma membrane & cell junctions.

Immunohistochemistry-Paraffin: B7-H4 Antibody [NBP2-30536] - Staining of human breast shows moderate membranous positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

B7-H4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VTCN1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  B7-H4 Protein (NBP2-30536PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for B7-H4 Antibody - BSA Free

• B7h.5
• B7H4
• B7-H4
• B7H4T-cell costimulatory molecule B7x
• B7S1
• B7S1VCTN1
• B7x
• B7XPRO1291
• FLJ22418
• Immune costimulatory protein B7-H4
• Protein B7S1
• T cell costimulatory molecule B7x
• V-set domain containing T cell activation inhibitor 1
• V-set domain-containing T-cell activation inhibitor 1
• Vtcn1

Background

B7H4 is a costimulatory protein which is reported to function as a negative regulator of T-cell mediated immunity. Although B7H4 binds an unknown receptor, it is thought to deliver an inhibitory signal to T-cells preventing their proliferation, cell cycle progression and interleukin-2 production. B7H4 deficient mice are only minimally affected, thus suggesting B7H4 is important in the fine tuning of the T-cell mediated immune response. B7H4 is expressed on activated T-cells, B-cells, monocytes and dendritic cells. Aberrant expression has been associated with cancers of the lung, breast and ovary in humans. B7H4 could be a useful prognostic marker in Renal Cell Carcinoma (RCC). There are three different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for B7-H4 Antibody (NBP2-30536)(2)

Publications using NBP2-30536

• Chen L, Xie Q, Wang Z et al. Assessment of combined expression of B7-H3 and B7-H4 as prognostic marker in esophageal cancer patients. Oncotarget. 2016-11-22 [PMID: 27764786] (IF/IHC, Human)
• Xu M, Zhang B, Zhang M et al. Clinical relevance of expression of B7-H1 and B7-H4 in ovarian cancer. Oncology Letters. 2016-01-01 [PMID: 27073557] (IHC-P, Human)

Bioinformatics

• Gene Symbol: VTCN1
• Uniprot:
  • Q7Z7D3()