B7-H4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: B7-H4 Antibody [NBP2-30536] - Immunofluorescent staining of human cell line MCF7 shows localization to plasma membrane & cell junctions.
Immunohistochemistry-Paraffin: B7-H4 Antibody [NBP2-30536] - Staining of human breast shows moderate membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

B7-H4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VTCN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
B7-H4 Protein (NBP2-30536PEP)
Publications
Read Publications using
NBP2-30536 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for B7-H4 Antibody

  • B7h.5
  • B7H4
  • B7-H4
  • B7H4T-cell costimulatory molecule B7x
  • B7S1
  • B7S1VCTN1
  • B7x
  • B7XPRO1291
  • FLJ22418
  • Immune costimulatory protein B7-H4
  • Protein B7S1
  • T cell costimulatory molecule B7x
  • V-set domain containing T cell activation inhibitor 1
  • V-set domain-containing T-cell activation inhibitor 1
  • Vtcn1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-76769
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-45549
Species: Hu
Applications: WB, Flow, IHC
AF1086
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
MAB342
Species: Hu
Applications: WB, AgAct
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP1-76770
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, ICC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
MAB7158
Species: Hu, Mu
Applications: WB, IHC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-12499
Species: Hu
Applications: IHC, IHC-P
AF1027
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, KO
AF165
Species: Hu
Applications: WB, Flow, CyTOF-ready

Publications for B7-H4 Antibody (NBP2-30536)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, IHC-P.


Filter By Application
IHC
(1)
IHC-P
(1)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for B7-H4 Antibody (NBP2-30536) (0)

There are no reviews for B7-H4 Antibody (NBP2-30536). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for B7-H4 Antibody (NBP2-30536) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional B7-H4 Products

Bioinformatics Tool for B7-H4 Antibody (NBP2-30536)

Discover related pathways, diseases and genes to B7-H4 Antibody (NBP2-30536). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for B7-H4 Antibody (NBP2-30536)

Discover more about diseases related to B7-H4 Antibody (NBP2-30536).
 

Pathways for B7-H4 Antibody (NBP2-30536)

View related products by pathway.

PTMs for B7-H4 Antibody (NBP2-30536)

Learn more about PTMs related to B7-H4 Antibody (NBP2-30536).

Blogs on B7-H4

There are no specific blogs for B7-H4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our B7-H4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VTCN1
Entrez
Uniprot