B3GALNT1 Antibody


Western Blot: B3GALNT1 Antibody [NBP1-59448] - Human Stomach, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

B3GALNT1 Antibody Summary

Synthetic peptides corresponding to B3GALNT1(beta-1,3-N-acetylgalactosaminyltransferase 1 (globoside blood group)) The peptide sequence was selected from the middle region of B3GALNT1. Peptide sequence PRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDT
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against B3GALNT1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for B3GALNT1 Antibody

  • b3Gal-T3
  • Beta-1,3-galactosyltransferase 3
  • Beta-1,3-GalNAc-T1
  • Beta-1,3-GalTase 3
  • beta-1,3-N-acetylgalactosaminyltransferase 1 (globoside blood group)
  • beta3GalT3
  • Beta3Gal-T3
  • beta-3-Gx-T3
  • brainiac1
  • EC
  • Galactosylgalactosylglucosylceramide beta-D-acetyl-galactosaminyltransferase
  • Gb4Cer
  • GLCT3
  • Globoside synthase
  • globotriaosylceramide 3-beta-N-acetylgalactosaminyltransferase
  • P antigen synthase
  • P blood group globoside
  • P
  • polypeptide 3 (Globosideblood group)
  • UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1
  • UDP-GalNAc:betaGlcNAc beta 1,3-galactosaminyltransferase, polypeptide 1(Globoside blood group)
  • UDP-GalNAc:betaGlcNAc beta-1,3-galactosaminyltransferase, polypeptide 1(Globoside blood group)
  • UDP-N-acetylgalactosamine:globotriaosylceramidebeta-1,3-N-acetylgalactosaminyltransferase


This gene is a member of the beta-1,3-galactosyltransferase (beta3GalT) gene family. B3GALNT1 is type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates (UDP-galactose and UDP-N-acetylglucosamine) and differe


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB

Publications for B3GALNT1 Antibody (NBP1-59448) (0)

There are no publications for B3GALNT1 Antibody (NBP1-59448).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B3GALNT1 Antibody (NBP1-59448) (0)

There are no reviews for B3GALNT1 Antibody (NBP1-59448). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for B3GALNT1 Antibody (NBP1-59448) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for B3GALNT1 Antibody (NBP1-59448)

Discover related pathways, diseases and genes to B3GALNT1 Antibody (NBP1-59448). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on B3GALNT1

There are no specific blogs for B3GALNT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our B3GALNT1 Antibody and receive a gift card or discount.


Gene Symbol B3GALNT1