B3GALNT1 Antibody

Images

 
Western Blot: B3GALNT1 Antibody [NBP1-59448] - Human Stomach, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

B3GALNT1 Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to B3GALNT1(beta-1,3-N-acetylgalactosaminyltransferase 1 (globoside blood group)) The peptide sequence was selected from the middle region of B3GALNT1. Peptide sequence PRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDTNLFFLYRIHLDVC The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
B3GALNT1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for B3GALNT1 Antibody

  • B3GALNT1
  • B3GALT3
  • b3Gal-T3
  • Beta-1,3-galactosyltransferase 3
  • Beta-1,3-GalNAc-T1
  • Beta-1,3-GalTase 3
  • beta-1,3-N-acetylgalactosaminyltransferase 1 (globoside blood group)
  • beta3GalT3
  • Beta3Gal-T3
  • beta-3-Gx-T3
  • Brainiac1
  • EC 2.4.1.79
  • Galactosylgalactosylglucosylceramide beta-D-acetyl-galactosaminyltransferase
  • Gb4Cer
  • Gb4Cer
  • GLCT3
  • Globoside Synthase
  • globotriaosylceramide 3-beta-N-acetylgalactosaminyltransferase
  • P antigen synthase
  • P blood group globoside
  • P
  • polypeptide 3 (Globosideblood group)
  • UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1
  • UDP-GalNAc:betaGlcNAc beta 1,3-galactosaminyltransferase, polypeptide 1(Globoside blood group)
  • UDP-GalNAc:betaGlcNAc beta-1,3-galactosaminyltransferase, polypeptide 1(Globoside blood group)
  • UDP-N-acetylgalactosamine:globotriaosylceramidebeta-1,3-N-acetylgalactosaminyltransferase

Background

This gene is a member of the beta-1,3-galactosyltransferase (beta3GalT) gene family. B3GALNT1 is type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates (UDP-galactose and UDP-N-acetylglucosamine) and differe

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
AF5866
Species: Hu
Applications: IHC, WB
NBP2-15104
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84957
Species: Hu
Applications: IHC, IHC-P, WB
H00000518-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-71702
Species: Ch, Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
H00201780-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-1607
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
NBP1-82859
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85965
Species: Hu
Applications: IHC, IHC-P
NBP1-84798
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-59875
Species: Hu
Applications: WB
NBP1-92355
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB600-326
Species: ET
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP2-38323
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-59448
Species: Hu
Applications: WB

Publications for B3GALNT1 Antibody (NBP1-59448) (0)

There are no publications for B3GALNT1 Antibody (NBP1-59448).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B3GALNT1 Antibody (NBP1-59448) (0)

There are no reviews for B3GALNT1 Antibody (NBP1-59448). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for B3GALNT1 Antibody (NBP1-59448) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional B3GALNT1 Products

Research Areas for B3GALNT1 Antibody (NBP1-59448)

Find related products by research area.

Blogs on B3GALNT1

There are no specific blogs for B3GALNT1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our B3GALNT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol B3GALNT1
Uniprot