Axl Recombinant Protein Antigen

Images

 
There are currently no images for Axl Recombinant Protein Antigen (NBP3-21382PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Axl Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Axl

Source: E.coli

Amino Acid Sequence: TATITVLPQQPRNLHLVSRQPTELEVAWTPGLSGIYPLTHCTLQAVLSDDGMGIQAGEPDPPEEPLTSQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AXL
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21382. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Axl Recombinant Protein Antigen

  • AI323647
  • ARK
  • AXL oncogene
  • AXL receptor tyrosine kinase
  • AXL transforming sequence/gene
  • Axl
  • EC 2.7.10
  • EC 2.7.10.1
  • JTK11
  • Tyro7
  • tyrosine-protein kinase receptor UFO
  • UFO
  • UFOoncogene AXL

Background

Axl is encoded by this gene is a member of the receptor tyrosine kinase subfamily. Although it is similar to other receptor tyrosine kinases, this protein represents a unique structure of the extracellular region that juxtaposes IgL and FNIII repeats. It transduces signals from the extracellular matrix into the cytoplasm by binding growth factors like vitamin K-dependent protein growth-arrest-specific gene 6. It is involved in the stimulation of cell proliferation and can also mediate cell aggregation by homophilic binding. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

885-GSB
Species: Hu
Applications: BA
MAB859
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, KO
AF591
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC
AF5534
Species: Hu
Applications: Flow, IHC, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
H00054778-M05
Species: Hu
Applications: ELISA, ICC/IF, KD, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
AF276
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IHC, KO, Simple Western, WB
H00008731-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-38464
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
1129-ER
Species: Hu
Applications: BA
M6000B
Species: Mu
Applications: ELISA
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB

Publications for Axl Recombinant Protein Antigen (NBP3-21382PEP) (0)

There are no publications for Axl Recombinant Protein Antigen (NBP3-21382PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Axl Recombinant Protein Antigen (NBP3-21382PEP) (0)

There are no reviews for Axl Recombinant Protein Antigen (NBP3-21382PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Axl Recombinant Protein Antigen (NBP3-21382PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Axl Products

Research Areas for Axl Recombinant Protein Antigen (NBP3-21382PEP)

Find related products by research area.

Blogs on Axl.

Microglia: pruning shears for homeostatic maintenance in the brain
By Jennifer Sokolowski, MD, PhD.Microglia play a critical role in pruning neurons and synapses during homeostatic maintenance in the adult brain.1 A recent study by Ayata et al. (2018) identified regional differe...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Axl Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AXL