Home » AWAT2 » AWAT2 Antibodies » AWAT2 Antibody

AWAT2 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: AWAT2 Antibody [NBP1-91574] - Human Brain lysate, concentration 0.2-1 ug/ml.
Western Blot: AWAT2 Antibody [NBP1-91574] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

AWAT2 Antibody Summary

Immunogen
Synthetic peptide directed towards the C terminal of human DGAT2L4. Peptide sequence GEPLPMPKIENPSQEIVAKYHTLYIDALRKLFDQHKTKFGISETQELEII. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AWAT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against DGAT2L4 and was validated on Western blot.
Theoretical MW
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-91574 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28096191)

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for AWAT2 Antibody

  • acyl-CoA wax alcohol acyltransferase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

WRN Antibody
NB100-471
Western Blot: WRN Antibody [NB100-471] - Human colon cancer cells with siRNA Control, siRNA pool of siWrn and 3 different sets of siRNA Wrn. GAPDH laoding control. Western blot image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: WRN Antibody [NB100-471] - Analysis of WRN in untreated, asynchronous HeLa cells using anti-WRN antibody. The primary antibody was used at a dilution of 1:100, incubated for 1 hour at room temperature in 1XPBS. Image from verified customer review.
Western Blot: WRN Antibody [NB100-471] - Whole cell lysate (5, 15 and 50 ug) from HeLa cells.
(2 Reviews)
(11 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IP, ChIP
CS Citrate
Synthase Antibody (17
NBP2-43648
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Non-transfected (Negative) and transfected (Positive) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Citrate synthetase antibody diluted at 1:1000. The HRP-conjugated anti-mouse IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (1761) [NBP2-43648] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Citrate synthetase protein stained by Citrate synthetase antibody [1761] diluted at 1:200. Red: phalloidin, a cytoskeleton marker, diluted at 1:50. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Analysis of mouse kidney. Citrate synthetase antibody [1761] dilution: 1:200.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
Elastin Antibody
(BA-4)
NB100-2076
Western Blot: Elastin Antibody (BA-4) [NB100-2076] - Analysis of tropoelastin using the mAb BA-4 elastin antibody (NB100-2076). A: Western blot of tropoelastin purified from bovine ligamentum nuchae tissue minces. B: Autoradiogram of a gradient SDS-polyacrylamide gel showing [3H] leucine-labeled tropoelasti.
Immunohistochemistry-Paraffin: Elastin Antibody (BA-4) [NB100-2076] - Presence of ECM proteins collagen, elastin, fibronectin, vitronectin and GAGs following decellularization. Porcine vena cavas were decellularized and analyzed for ECM proteins. Cross-section of paraffin embedded samples were immunostained for collagen type I/III, elastin, fibronectin and vitronectin. Images were taken at identical microscopy settings. Scale bar is 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0220743), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Elastin Antibody (BA-4) [NB100-2076] - Elastin surrounding blood vessel in pig testis. Image from verified customer review.
(2 Reviews)
(5 Publications)
Species: Hu, Po, Ca, Fe, Gt, Gp, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Blooms Syndrome
Protein Blm Antibody
NB100-214
Western Blot: Blooms Syndrome Protein Blm Antibody [NB100-214] - Samples: Whole cell lysate (15 ug) from HEK293T, K-562, Jurkat, HeLa, and A-549 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-BLM antibody NB100-214 (lot 4) used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Western Blot: Blooms Syndrome Protein Blm Antibody [NB100-214] - Samples: Whole cell lysate (50 ug) from TCMK-1 and BIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-BLM antibody NB100-214 (lot 4) used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 75 seconds.
Immunoprecipitation: Blooms Syndrome Protein Blm Antibody [NB100-214] - Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HEK293T cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-BLM antibody (NB100-214, lot 4) used for IP at 6 ug per reaction. BLM was also immunoprecipitated by a previous lot of this antibody (lot 3). For blotting immunoprecipitated BLM, NB100-214 was used at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
(7 Publications)
Species: Hu, Mu
Applications: WB, IP
Pax3 Antibody
(274212) [Unconjugate
MAB2457
Pax3 was detected in immersion fixed B16‑F1 mouse melanoma cell line using Mouse Anti-Human/Mouse Pax3 Monoclonal Antibody (Catalog # MAB2457) at 2 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Review)
(9 Publications)
Species: Hu, Mu
Applications: WB, CyTOF-ready, ICC, ICFlow
DGAT1 Antibody
NB110-41487
Western Blot: DGAT1 Antibody [NB110-41487] - Detection of DGAT1 in HepG2 lysate.
Immunocytochemistry/Immunofluorescence: DGAT1 Antibody [NB110-41487] - HepG2 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton X-100. The cells were incubated with anti-DGAT1 at 5 ug/ml overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: DGAT1 Antibody [NB110-41487] - Factors regulating lipid storage and breakdown in C2C12 muscle cells.Muscle cells were incubated with PALM (open), NORM (filled), or HSFA (hatched). Pictured is protein abundance of DGAT1. In the figure panel, the data is expressed relative to a no fatty acid control condition (0mM). In panel B, #P<0.05 for a main effect of HSFA vs. PALM and NORM. Representative blot shown inset above the figure panel. DGAT = diacylglycerol acyltransferase; AU = arbitrary units. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0120871), licensed under a CC-BY licence.
(1 Review)
(14 Publications)
Species: Hu, Mu, Rt
Applications: WB, IB, ICC/IF
LRAT Antibody
(M34-P1F10)
NBP2-50444
Western Blot: LRAT Antibody (M34-P1F10) [NBP2-50444] - Shows detection of LRAT in an overexpression lysate.
Immunocytochemistry/Immunofluorescence: LRAT Antibody (M34-P1F10) [NBP2-50444]
Immunohistochemistry: LRAT Antibody (M34-P1F10) [NBP2-50444]
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Endothelin-3
Antibody (2A6-2A4)
H00001908-M01
Western Blot: Endothelin-3 Antibody (2A6-2A4) [H00001908-M01] - Analysis of EDN3 expression in transfected 293T cell line by EDN3 monoclonal antibody (M01), clone 2A6-2A4.Lane 1: EDN3 transfected lysate(25.5 KDa).Lane 2: Non-transfected lysate.
Western Blot: Endothelin-3 Antibody (2A6-2A4) [H00001908-M01] - EDN3 monoclonal antibody (M01), clone 2A6-2A4 Analysis of EDN3 expression in LNCaP.
Immunoprecipitation: Endothelin-3 Antibody (2A6-2A4) [H00001908-M01] - Analysis of EDN3 transfected lysate using anti-EDN3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with EDN3 MaxPab rabbit polyclonal antibody.
(1 Publication)
Species: Hu
Applications: WB, ELISA, IP, S-ELISA
Dehydrodolichyl
Diphosphate Synthase ...
NBP1-84975
Immunohistochemistry-Paraffin: Dehydrodolichyl Diphosphate Synthase Antibody [NBP1-84975] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
POMC Antibody
NB100-1533
Western Blot: POMC Antibody [NB100-1533] - Staining of NIH3T3 cell lysate with antibody at 0.3 ug/mL (A) and Rat Brain cell lysate with antibody at 2 ug/mL (B). 35 ug protein in RIPA buffer. Detected by chemiluminescence.
Immunohistochemistry: POMC Antibody [NB100-1533] - Representative confocal images of POMC in POMC-transfected WT and Sel1L-/- N2a cells. White arrows point to POMC-containing secretory granules, while yellow arrows point to perinuclear POMC. KDEL marks the ER. Representative data from at least 2 independent experiments are shown. Image collected and cropped by CiteAb from the following publication (jci.org/articles/view/96420), licensed under a CC-BY licence.
Flow Cytometry: POMC Antibody [NB100-1533] - Flow cytometric analysis of paraformaldehyde fixed A431 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(10 Publications)
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
EDNRB/Endothelin R
Type B Antibody
NLS54
Immunocytochemistry/Immunofluorescence: EDNRB/Endothelin R Type B Antibody [NLS54] - Analysis of anti-EDNRB / Endothelin B Receptor antibody with transfected cells expressing Endothelin B Receptor at 4 ug/ ml.
Immunohistochemistry-Paraffin: EDNRB/Endothelin R Type B Antibody [NLS54] - Brain, Alzheimer's senile plaque
Immunocytochemistry/Immunofluorescence: EDNRB/Endothelin R Type B Antibody [NLS54] - Analysis of anti-EDNRB / Endothelin B Receptor antibody with cells expressing vector only using this antibody at 4 ug/ ml.
(2 Publications)
Species: Hu, Mu, Ca
Applications: WB, ICC/IF, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(33 Reviews)
(647 Publications)
Species: Hu
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Western Blot: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Probing of Western blots of pancreatic lysates from control and iron overloaded Tg40 PrP and PrP-/- mice with antibodies specific for insulin dimer and pentamer (upper and lower panels) shows decreased expression in Tg40 PrP relative to PrP-/- samples (lanes 1 & 5 vs. 3 & 7). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Immunohistochemistry of pancreas shows relatively higher reactivity for insulin in PrP-/- relative to Tg40 PrP sections (panels 1 & 3). Iron overloading decreases insulin reactivity in Tg40 PrP but not in PrP-/- samples (panels 1 vs. 2 & 3 vs. 4). Reaction for glucagon is higher in iron overloaded Tg40 PrP relative to control samples (panels 5 & 6). The difference is minimal in PrP-/- samples (panels 7 & 8). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
(5 Reviews)
(1 Publication)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Peripherin 2/PRPH2
Antibody
NBP1-86687
Western Blot: Peripherin 2/PRPH2 Antibody [NBP1-86687] - Analysis in control (vector only transfected HEK293T lysate) and PRPH2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Peripherin 2/PRPH2 Antibody [NBP1-86687] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Peripherin 2/PRPH2 Antibody [NBP1-86687] - Staining of retina shows strong cytoplasmic positivity in photoreceptors.
Species: Hu
Applications: WB, IHC, IHC-P
DHPS Antibody
NBP1-82648
Western Blot: DHPS Antibody [NBP1-82648] - Analysis in control (vector only transfected HEK293T lysate) and DHPS over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: DHPS Antibody [NBP1-82648] - Staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DHPS Antibody [NBP1-82648] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Band 3 Antibody
(BIII 136)
NB120-11012
Western Blot: Band 3 Antibody (BIII 136) [NB120-11012] - Human erythrocytes ghosts extract was separated on SDS-PAGE and probed with Monoclonal Anti-Band 3 Clone: BIII-136. The antibody was developed using Goat Anti-Mouse IgG-Peroxidase and AEC substrate.
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
GP1BB Antibody
NBP3-04913
Western Blot: GP1BB Antibody [NBP3-04913] - Analysis of extracts of various cell lines, using GP1BB antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit
Species: Hu, Mu, Rt
Applications: WB
Thymidylate
Synthase Antibody (SP
NBP2-34390
Immunohistochemistry-Paraffin: Thymidylate Synthase Antibody (SPM453) [NBP2-34390] - Formalin-fixed, paraffin-embedded human Testicular Carcinoma stained with Thymidylate Synthase Antibody (SPM453).
Flow (Intracellular): Thymidylate Synthase Antibody (SPM453) [NBP2-34390] - An intracellular stain was performed on Hek293 cells with Thymidylate Synthase Antibody [SPM453] NBP2-34441PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin. Image using the PE format of this antibody.
Flow (Intracellular): Thymidylate Synthase Antibody (SPM453) [NBP2-34390] - An intracellular stain was performed on HEK293 cells with Thymidylate Synthase Antibody [SPM453] NBP2-34441PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin. Image using the Azide and BSA Free format of this antibody.
(1 Review)
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
GRIP1 Antibody
NBP2-41211
Western Blot: GRIP1 Antibody [NBP2-41211] - Analysis of GRIP1 in 293 cell lysate with GRIP1 antibody at 1 ug/mL in (A) the absence and (B) the presence of blocking peptide.
Immunohistochemistry: GRIP1 Antibody [NBP2-41211] - Immunohistochemistry of GRIP1 in rat brain tissue with GRIP1 antibody at 2.5 ug/ml.
Immunofluorescence: GRIP1 Antibody [NBP2-41211] - Immunofluorescence of GRIP1 in rat brain tissue with GRIP1 antibody at 20 ug/ml.
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF

Publications for AWAT2 Antibody (NBP1-91574)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for AWAT2 Antibody (NBP1-91574) (0)

There are no reviews for AWAT2 Antibody (NBP1-91574). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AWAT2 Antibody (NBP1-91574) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional AWAT2 Products

Bioinformatics Tool for AWAT2 Antibody (NBP1-91574)

Discover related pathways, diseases and genes to AWAT2 Antibody (NBP1-91574). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AWAT2 Antibody (NBP1-91574)

Discover more about diseases related to AWAT2 Antibody (NBP1-91574).
 

Pathways for AWAT2 Antibody (NBP1-91574)

View related products by pathway.

Blogs on AWAT2

There are no specific blogs for AWAT2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AWAT2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol AWAT2
Uniprot