Aurora C Antibody

Images

 
Immunohistochemistry: Aurora C Antibody [NBP1-90819] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Aurora C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AURKC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Aurora C Protein (NBP1-90819PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Aurora C Antibody

  • AIE2AIK3
  • ARK3Serine/threonine-protein kinase aurora-C
  • AurC
  • aurora kinase CAurora/IPL1/Eg2 protein 2
  • Aurora/IPL1-related kinase 3
  • aurora-C
  • Aurora-related kinase 3
  • EC 2.7.11
  • EC 2.7.11.1
  • serine/threonine kinase 13 (aurora/IPL1-like)
  • serine/threonine-protein kinase 13
  • STK13ARK-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-37471
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
H00027033-B02P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB110-85519
Species: Hu, Mu
Applications: WB, ELISA, IHC, IP
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
H00009266-M02
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP1-81765
Species: Hu
Applications: IHC, IHC-P
NBP1-69668
Species: Hu
Applications: WB
NBP2-07087
Species: Hu
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NBP1-97587
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-12892
Species: Hu
Applications: WB, ICC/IF
NBP1-90819
Species: Hu
Applications: IHC, IHC-P

Publications for Aurora C Antibody (NBP1-90819) (0)

There are no publications for Aurora C Antibody (NBP1-90819).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aurora C Antibody (NBP1-90819) (0)

There are no reviews for Aurora C Antibody (NBP1-90819). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Aurora C Antibody (NBP1-90819) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Aurora C Products

Bioinformatics Tool for Aurora C Antibody (NBP1-90819)

Discover related pathways, diseases and genes to Aurora C Antibody (NBP1-90819). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aurora C Antibody (NBP1-90819)

Discover more about diseases related to Aurora C Antibody (NBP1-90819).
 

Pathways for Aurora C Antibody (NBP1-90819)

View related products by pathway.

PTMs for Aurora C Antibody (NBP1-90819)

Learn more about PTMs related to Aurora C Antibody (NBP1-90819).
 

Research Areas for Aurora C Antibody (NBP1-90819)

Find related products by research area.

Blogs on Aurora C

There are no specific blogs for Aurora C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aurora C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AURKC