AUF1 Antibody [DyLight 680]

Product Discontinued

AUF1 Antibody [DyLight 680] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-306 of human AUF1 (NP_002129.2).
  
  Sequence:
  MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGDQQSGYGKVSRRGGHQNSYKPY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HNRNPD
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for AUF1 Antibody [DyLight 680]

• AUF1A
• heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein1, 37kDa)
• heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA-binding protein1, 37kD)
• heterogeneous nuclear ribonucleoprotein D0
• hnRNPD0
• type A

Background

hnRNP D/AUF1 binds with high affinity to RNA molecules that contain AU-rich elements (AREs) found within the 3' untranslated regions of many protooncogenes and cytokine mRNAs. It also binds to double and single stranded DNA sequences in a specific manner and functions a transcription factor. Each of the RNA-binding domains specifically can bind solely to a single stranded nonmonotonous 5'-UUAG-3' sequence and also weaker to the single-stranded 5'-TTAGGG-3' telomeric DNA repeat. It may be involved in translationally coupled mRNA turnover (referenced from swissprot).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HNRNPD