Attractin Antibody

Images

 
Immunohistochemistry-Paraffin: Attractin Antibody [NBP1-87967] - Staining of human small intestine shows weak cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Attractin Antibody [NBP1-87967] - Staining of human cervix, uterine shows weak membranous positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: Attractin Antibody [NBP1-87967] - Staining of human liver shows very weak membranous positivity in hepatocytes.
Immunohistochemistry-Paraffin: Attractin Antibody [NBP1-87967] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Attractin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLLSDILVFTSEQCDAHRSEAACLAAGPGIRCVWNTGSSQCISWALATDEQEEKLKSECFSKRTLDHDRCDQHTDCYSCTANTNDCHWCNDHCVPRNHSCSEGQISIFRYENCPKDNPMYYCNKKTSCRSCALDQNCQWE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATRN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
IHC-P, WB reported in scientific literature (PMID: 25260943). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
159 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Attractin Protein (NBP1-87967PEP)
Publications
Read Publications using
NBP1-87967 in the following applications:

  • 1 publication
  • WB
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Attractin Antibody

  • ATRN
  • Attractin
  • DPPT-L
  • KIAA0548
  • Mahogany Protein
  • MGC126754
  • MGCA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1180
Species: Hu
Applications: ICC, IHC, Simple Western, WB
9094-AG
Species: Hu
Applications: BA
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
DAGR00
Species: Hu
Applications: ELISA
NLS1040
Species: Hu, Pm
Applications: IHC, IHC-P
NBP2-72665
Species: Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, ICC/IF, WB
NBP1-88861
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-87404
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31754
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
DLP00
Species: Hu
Applications: ELISA
H00004340-B01P
Species: Hu, Rt
Applications: WB
236-EG
Species: Hu
Applications: BA
NBP2-31361
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-41103
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB
NBP1-87967
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Attractin Antibody (NBP1-87967)(2)

Reviews for Attractin Antibody (NBP1-87967) (0)

There are no reviews for Attractin Antibody (NBP1-87967). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Attractin Antibody (NBP1-87967) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Attractin Products

Bioinformatics Tool for Attractin Antibody (NBP1-87967)

Discover related pathways, diseases and genes to Attractin Antibody (NBP1-87967). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Attractin Antibody (NBP1-87967)

Discover more about diseases related to Attractin Antibody (NBP1-87967).
 

Pathways for Attractin Antibody (NBP1-87967)

View related products by pathway.

PTMs for Attractin Antibody (NBP1-87967)

Learn more about PTMs related to Attractin Antibody (NBP1-87967).
 

Research Areas for Attractin Antibody (NBP1-87967)

Find related products by research area.

Blogs on Attractin

There are no specific blogs for Attractin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Attractin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATRN
Entrez
Uniprot