Attractin Antibody

Immunohistochemistry-Paraffin: Attractin Antibody [NBP1-87967] - Staining of human small intestine shows weak cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Attractin Antibody [NBP1-87967] - Staining of human cervix, uterine shows weak membranous positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: Attractin Antibody [NBP1-87967] - Staining of human liver shows very weak membranous positivity in hepatocytes.

Immunohistochemistry-Paraffin: Attractin Antibody [NBP1-87967] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Attractin Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LLLSDILVFTSEQCDAHRSEAACLAAGPGIRCVWNTGSSQCISWALATDEQEEKLKSECFSKRTLDHDRCDQHTDCYSCTANTNDCHWCNDHCVPRNHSCSEGQISIFRYENCPKDNPMYYCNKKTSCRSCALDQNCQWE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATRN
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC-P, WB reported in scientific literature (PMID: 25260943). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Theoretical MW: 159 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  Attractin Protein (NBP1-87967PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Attractin Antibody

• ATRN
• Attractin
• DPPT-L
• KIAA0548
• Mahogany Protein
• MGC126754
• MGCA

Background

Attractin is a serum glycoprotein of 175 kDaand found in both membrane-bound and secreted forms as a result of alternative splicing. Both the secreted and membrane-bound forms of attractin may be involved in the development and maintenance of the central nervous system. Membrane-bound attractin is a co-receptor for Agouti, antagonist of melanocortin-1 receptor. Secreted attractin, expressed by activated T lymphocytes and modulates interactions between T cells and monocytes/macrophages, was examined as a potential marker of immune activity. Attractinmay be a component of a pathway for regulated protein turnover that also involves mahogunin, a wide-expressed E3 ubiquitinligase found at particularly high levels in the brain. Attractinwas considered as an extracellular target amenable for the development of obesity-regulating drugs, also.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Attractin Antibody (NBP1-87967)(2)

Publications using NBP1-87967

• Winge SB, Nielsen J, Jorgensen A et al. Biglycan is a novel binding partner of fibroblast growth factor receptor 3c (FGFR3c) in the human testis. Mol. Cell. Endocrinol. 2014-09-23 [PMID: 25260943] (IHC-P, WB, Human)
  
  Details:
  Attractin/ATRN antibody used for IHC-P on human testes at 1:200 dilution of primary with 10 mM citrate pH 6 antigen retrieval method - Fig.?2 shows the ATRN expression primarily in the spermatocytes and spermatids. Antibody also used for WB at 1:400 dilution - Figure S2 shows the WB image of ATTN in Human Testes and Prostate lysates - 230?kDa band corresponding to the glycosylated form, 160?kDa band corresponding to the non-glycosylated form and 130?kDa/55?kDa corresponding to truncated forms.
• Wu CC, Hsu CW, Chen CD et al. Candidate Serological Biomarkers for Cancer Identified from the Secretomes of 23 Cancer Cell Lines and the Human Protein Atlas. Mol Cell Proteomics 2010-06-01 [PMID: 20124221]

Bioinformatics

• Gene Symbol: ATRN
• Entrez:
  • 8455(Human)
• Uniprot:
  • O75882()