ATRX Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ATRX Antibody [NBP2-55953] - Staining of human cell line SH-SY5Y shows localization to nuclear bodies.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ATRX Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ATRX Antibody - BSA Free (NBP2-55953) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EFRAMDAVNKEKNTKEHKVIDAKFETKARKGEKPCALEKKDISKSEAKLSRKQVDSEHMHQNVPTEEQRTNKSTGGEHKKSDRKEEPQYEPANTSE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATRX
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ATRX Recombinant Protein Antigen (NBP2-55953PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ATRX Antibody - BSA Free

• alpha thalassemia/mental retardation syndrome X-linked (RAD54 (S. cerevisiae)homolog)
• alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S.cerevisiae)
• alpha thalassemia/mental retardation syndrome X-linked
• ATP-dependent helicase ATRX
• ATR2
• DNA dependent ATPase and helicase
• EC 3.6.1
• EC 3.6.4.12
• helicase 2, X-linked
• Juberg-Marsidi syndrome
• MGC2094
• MRXHF1
• RAD54 homolog
• RAD54L
• SFM1
• SHS
• transcriptional regulator ATRX
• XH2RAD54
• X-linked helicase II
• X-linked nuclear protein
• XNPZNF-HX
• Zinc finger helicase
• Znf-HX

Background

ATRX is encoded by this gene contains an ATPase/helicase domain, and thus it belongs to the SWI/SNF family of chromatin remodeling proteins. The mutations of this gene are associated with an X-linked mental retardation (XLMR) syndrome most often accompanied by alpha-thalassemia (ATRX) syndrome. These mutations have been shown to cause diverse changes in the pattern of DNA methylation, which may provide a link between chromatin remodeling, DNA methylation, and gene expression in developmental processes. This protein is found to undergo cell cycle-dependent phosphorylation, which regulates its nuclear matrix and chromatin association, and suggests its involvement in the gene regulation at interphase and chromosomal segregation in mitosis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATRX