ATR Antibody (1E9)

Images

 
Immunohistochemistry-Paraffin: ATR Antibody (1E9) [H00000545-M03] - Analysis of monoclonal antibody to ATR on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml

Product Details

Summary
Reactivity Hu, Rt, HaSpecies Glossary
Applications WB, ELISA, IHC, IHC-P
Clone
1E9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ATR Antibody (1E9) Summary

Immunogen
ATR (NP_001175, 2545 a.a. ~ 2644 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNETGEVVNEKAKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGWTPYM
Specificity
ATR - ataxia telangiectasia and Rad3 related (1E9)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ATR
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • ELISA
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
Antibody reactivity Against Recombinant Protein with GST tag on ELISA. GST tag alone is used as a negative control. It has been used for IHC-P. WB usage was reported in scientific literature. WB reported in scientific literature (PMID: 23451157). Use in Immunohistochemistry reported in scientific literature (PMID: 30746633).
Publications
Read Publications using
H00000545-M03 in the following applications:

  • IHC
    1 publication
  • 2 publications
  • WB
    1 publication

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 29396668). Hamster reported in scientific literature (PMID: 23451157).

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATR Antibody (1E9)

  • ataxia telangiectasia and Rad3 related
  • Ataxia telangiectasia and Rad3-related protein
  • ATR
  • EC 2.7.11.1
  • FRAP-related protein 1
  • FRP1
  • FRP1FRAP-related protein-1
  • MEC1
  • protein kinase ATR
  • Rad3 related protein
  • SCKL1
  • SCKLMEC1, mitosis entry checkpoint 1, homolog
  • serine/threonine-protein kinase ATR

Background

The protein encoded by this gene belongs the PI3/PI4-kinase family, and is most closely related to ATM, a protein kinase encoded by the gene mutated in ataxia telangiectasia. This protein and ATM share similarity with Schizosaccharomyces pombe rad3, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This kinase has been shown to phosphorylate checkpoint kinase CHK1, checkpoint proteins RAD17, and RAD9, as well as tumor suppressor protein BRCA1. Mutations of this gene are associated with Seckel syndrome. An alternatively spliced transcript variant of this gene has been reported, however, its full length nature is not known. Transcript variants utilizing alternative polyA sites exist. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-309
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD
NB100-464
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-56546
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF2288
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ISH, PAGE, KO
NBP2-24457
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
NB100-404
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
NBP2-22128
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-80695
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-13600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-247
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-02004
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-304
Species: Hu, Mu, Rt, Bt, Bv, Ca, Fi, Gt, Pm
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ISH, Flow-IC, KD, KO
NB100-56155
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-148
Species: Hu, Mu, Rt, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, KD
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ATR Antibody (H00000545-M03)(5)

We have publications tested in 3 confirmed species: Human, Rat, Hamster.

We have publications tested in 3 applications: IHC, IHC-P, WB.


Filter By Application
IHC
(1)
IHC-P
(2)
WB
(1)
All Applications
Filter By Species
Human
(3)
Rat
(1)
Hamster
(1)
All Species

Reviews for ATR Antibody (H00000545-M03) (0)

There are no reviews for ATR Antibody (H00000545-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATR Antibody (H00000545-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ATR Products

Array H00000545-M03

Bioinformatics Tool for ATR Antibody (H00000545-M03)

Discover related pathways, diseases and genes to ATR Antibody (H00000545-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATR Antibody (H00000545-M03)

Discover more about diseases related to ATR Antibody (H00000545-M03).
 

Pathways for ATR Antibody (H00000545-M03)

View related products by pathway.

PTMs for ATR Antibody (H00000545-M03)

Learn more about PTMs related to ATR Antibody (H00000545-M03).
 

Research Areas for ATR Antibody (H00000545-M03)

Find related products by research area.

Blogs on ATR.

Further unraveling the role of gamma H2AX in DNA damage response
Our genome experiences a moderate amount of DNA damage in our cells on a daily basis.  This DNA damage can be in response to external environmental factors, or be a result of our internal metabolic processes going awry.  While normal rates of DNA ...  Read full blog post.

The recent relationship of BRCA1 and 53BP1
The p53-binding protein 1 (53BP1) is a DNA damage response factor, which is recruited to nuclear structures at the site of DNA damage.  DNA double-strand breaks (DSBs) are mutations that are detrimental to cell viability and genome stability, and m...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATR Antibody (1E9) and receive a gift card or discount.

Bioinformatics

Gene Symbol ATR
Entrez
Uniprot