ATP7b Antibody (3A12)

Product Discontinued

ATP7b Antibody (3A12) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: ATP7B (NP_000044, 1372 a.a. - 1465 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QLKCYKKPDLERYEAQAHGHMKPLTASQVSVHIGMDDRWRDSPRATPWDQVSYVSQVSLSSLTSDKPSRHSAAADDDGDKWSLLLNGRDEEQYI
• Specificity: ATP7B - ATPase, Cu++ transporting, beta polypeptide (3A12)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ATP7B
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATP7b Antibody (3A12)

• ATPase, Cu(2+)- transporting, beta polypeptide
• ATPase, Cu++ transporting, beta polypeptide
• Copper pump 2
• copper-transporting ATPase 2
• EC 3.6.3
• EC 3.6.3.4
• PWD
• WC1
• WD
• Wilson disease-associated protein
• WNDATPase, Cu++ transporting, beta polypeptide (Wilson disease)

Background

This gene is a member of the P-type cation transport ATPase family and encodes a protein with several membrane-spanning domains, an ATPase consensus sequence, a hinge domain, a phosphorylation site, and at least 2 putative copper-binding sites. This protein functions as a monomer, exporting copper out of the cells, such as the efflux of hepatic copper into the bile. Alternate transcriptional splice variants, encoding different isoforms with distinct cellular localizations, have been characterized. Mutations in this gene have been associated with Wilson disease (WD). [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP7B
• Entrez:
  • 540(Human)
• Uniprot:
  • NP_000044(Human)