ATP7A Antibody


Western Blot: ATP7A Antibody [NBP1-54906] - HepG2 Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide Primary Antibody Concentration: 2.0 ug/ml Peptide Concentration: 2.0 ug/ml lysate Quantity: 25ug/ more
Immunohistochemistry: ATP7A Antibody [NBP1-54906] - Human alveolar cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.
Western Blot: ATP7A Antibody [NBP1-54906] - HepG2 cell lysate, Antibody Titration: 0.5ug/ml
Immunohistochemistry-Paraffin: ATP7A Antibody [NBP1-54906] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

ATP7A Antibody Summary

Synthetic peptides corresponding to ATP7A (ATPase, Cu++ transporting, alpha polypeptide (Menkes syndrome)) The peptide sequence was selected from the N terminal of ATP7A. Peptide sequence MKKQIEAMGFPAFVKKQPKYLKLGAIDVERLKNTPVKSSEGSQQRSPSYQ
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against ATP7A and was validated on Western Blot and immunohistochemistry-P
Theoretical MW
163 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ATP7A Protein (NBP1-54906PEP)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ATP7A Antibody

  • ATPase, Cu++ transporting, alpha polypeptide
  • Copper pump 1
  • copper-transporting ATPase 1
  • Cu++-transporting P-type ATPase
  • EC 3.6.3
  • EC
  • MC1
  • Menkes disease-associated protein
  • Menkes syndrome
  • MK
  • MNKFLJ17790
  • OHS
  • SMAX3


The ATP7A gene encodes the Menkes copper-translocating P-type ATPase, a ubiquitous protein that regulates the absorption of copper in the gastrointestinal tract. Inside cells, this protein has a dual function: it delivers copper to cuproenzymes in the Golgi compartment and effluxes excess copper. The trafficking mechanism and catalytic activity combine to facilitate absorption and intercellular transport of copper. Menkes disease, a systemic copper deficiency disorder, is caused by mutations in the ATP7A gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Simple Western, IP, ICC
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for ATP7A Antibody (NBP1-54906) (0)

There are no publications for ATP7A Antibody (NBP1-54906).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP7A Antibody (NBP1-54906) (0)

There are no reviews for ATP7A Antibody (NBP1-54906). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP7A Antibody (NBP1-54906) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ATP7A Products

Bioinformatics Tool for ATP7A Antibody (NBP1-54906)

Discover related pathways, diseases and genes to ATP7A Antibody (NBP1-54906). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP7A Antibody (NBP1-54906)

Discover more about diseases related to ATP7A Antibody (NBP1-54906).

Pathways for ATP7A Antibody (NBP1-54906)

View related products by pathway.

PTMs for ATP7A Antibody (NBP1-54906)

Learn more about PTMs related to ATP7A Antibody (NBP1-54906).

Blogs on ATP7A

There are no specific blogs for ATP7A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ATP7A Antibody and receive a gift card or discount.


Gene Symbol ATP7A