ATP7A Antibody

Product Discontinued

ATP7A Antibody Summary

• Immunogen: Synthetic peptides corresponding to ATP7A (ATPase, Cu++ transporting, alpha polypeptide, Menkes syndrome). The peptide sequence was selected from the N-terminal of ATP7A. Peptide sequence MKKQIEAMGFPAFVKKQPKYLKLGAIDVERLKNTPVKSSEGSQQRSPSYQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP7A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against ATP7A and was validated on Western Blot and immunohistochemistry-P
• Theoretical MW: 163 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: No Preservative
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ATP7A Antibody

• ATPase, Cu++ transporting, alpha polypeptide
• Copper pump 1
• copper-transporting ATPase 1
• Cu++-transporting P-type ATPase
• DSMAX
• EC 3.6.3
• EC 3.6.3.4
• MC1
• Menkes disease-associated protein
• Menkes syndrome
• MK
• MNKFLJ17790
• OHS
• SMAX3

Background

The ATP7A gene encodes the Menkes copper-translocating P-type ATPase, a ubiquitous protein that regulates the absorption of copper in the gastrointestinal tract. Inside cells, this protein has a dual function: it delivers copper to cuproenzymes in the Golgi compartment and effluxes excess copper. The trafficking mechanism and catalytic activity combine to facilitate absorption and intercellular transport of copper. Menkes disease, a systemic copper deficiency disorder, is caused by mutations in the ATP7A gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ATP7A Antibody (NBP1-54906)(2)

Publications using NBP1-54906

• Schoonover K, Roberts R. Isoform and protein region abnormalities of dysbindin and copper transporter proteins in postmortem schizophrenia substantia nigra. bioRxiv 2018-06-09 (WB, Human)
• Schoonover KE, Roberts RC Markers of copper transport in the cingulum bundle in schizophrenia Schizophrenia research 2021-01-09 [PMID: 33434726] (WB, Human)

Bioinformatics

• Gene Symbol: ATP7A
• Uniprot:
  • Q04656(Human)