ATP6V1G3 Antibody - Azide and BSA Free

Western Blot: ATP6V1G3 Antibody [NBP2-92742] - Analysis of extracts of mouse kidney, using ATP6V1G3 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s.

Immunohistochemistry-Paraffin: ATP6V1G3 Antibody [NBP2-92742] - Mouse kidney using ATP6V1G3 antibody at dilution of 1:100 (40x lens).

• Reactivity: Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ATP6V1G3 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human ATP6V1G3 (NP_573569.1). MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP6V1G3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50-1:100
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for ATP6V1G3 Antibody - Azide and BSA Free

• ATPase, H+ transporting, lysosomal 13kD, V1 subunit G isoform 3
• ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G isoform 3
• ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3
• H+ transporting, lysosomal (vacuolar proton pump) subunit G3
• MGC119810
• MGC119813
• vacuolar ATP synthase subunit G 3
• vacuolar proton pump G subunit 3
• Vacuolar proton pump subunit G 3
• vacuolar proton pump, subunit G3
• V-ATPase 13 kDa subunit 3
• V-ATPase G subunit 3
• V-ATPase G3 subunit
• V-ATPase subunit G 3
• V-type proton ATPase subunit G 3

Background

ATP6V1G3 encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'' and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes one of three G subunit proteins. Transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: ATP6V1G3